BioLiP

>protein
MFRMPIVTMERVDSFSAAHRLHSEKLSDAENKETFGKCNNSNGHGHNYVWKVKLRGEVDPTSGMVYDLAKLKKEMSLVLD
TVDHRNLDKDVEFFKTTVSTSENVAIYMFEKLKSVMSNPSVLYKVTIEETPKNIFTYKGS

The query sequence (length=140) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	2g64:A	140	140	1.0000	1.0000	1.0000	3.66e-103
2	1b66:A	138	127	0.4786	0.4855	0.5276	6.07e-42	1b66:B, 1b6z:A, 1b6z:B, 1gtq:A, 1gtq:B
3	2oba:B	121	126	0.2571	0.2975	0.2857	3.85e-10	2oba:A, 2oba:C, 2oba:D, 2oba:E, 2oba:F
4	4ntk:A	121	126	0.2571	0.2975	0.2857	2.68e-09	4ntk:E, 4ntk:B, 4ntk:C, 4ntk:D, 4ntk:F, 4ntm:A, 4ntm:E, 4ntm:B, 4ntm:C, 4ntm:D, 4ntm:F, 4ntn:A, 4ntn:B, 4ntn:C, 4ntn:D, 4ntn:E, 4ntn:F, 3qn0:A, 3qn0:B, 3qn0:C, 3qn0:D, 3qn0:E, 3qn0:F, 3qn9:A, 3qn9:B, 3qna:A, 3qna:B, 3qna:C, 3qna:D, 3qna:E, 3qna:F
5	2dtt:B	115	90	0.1857	0.2261	0.2889	6.84e-06	2dtt:A, 2dtt:C, 2dtt:D, 2dtt:F, 2dtt:E
6	2a0s:A	163	41	0.1143	0.0982	0.3902	0.017	2a0s:B, 3lx3:A, 3lze:A, 3m0n:A
7	1y13:A	163	41	0.1214	0.1043	0.4146	0.035	1y13:C, 1y13:B
8	9cf1:P	726	119	0.1929	0.0372	0.2269	0.52	9cf0:P, 9cf2:P, 9cf3:P
9	7v0f:A	182	64	0.1357	0.1044	0.2969	0.65	7v0f:B
10	5yrp:A	224	70	0.1357	0.0848	0.2714	3.5	5yrp:B
11	5faw:B	806	45	0.1071	0.0186	0.3333	5.4	5fau:A, 5fau:B, 5fau:C, 5fau:D, 5faw:A, 5fay:A, 5fay:B, 6nd3:A, 6nd3:B, 6nd3:C, 6nd3:D, 6nd3:E, 6nd3:F, 6nd3:G, 6nd3:H, 6vue:A, 6vue:B
12	4s1h:A	287	46	0.0857	0.0418	0.2609	9.8	4s1h:B, 4s1i:A, 4s1i:B

[Back]