MFIRIKCFSKQPIAKKVSREVSAYLEYTGNNTWEGHISGQGVSNLQTKLINVGKGVKVVCNYQDKVLFAIGNVAMSDTGS
V
The query sequence (length=81) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8k22:A | 929 | 81 | 1.0000 | 0.0872 | 1.0000 | 3.20e-50 | 8k21:a, 8k22:a, 8k23:A, 8k23:a, 8k24:a, 8k24:A, 8k25:A, 8k25:a |
2 | 6lvb:A | 762 | 31 | 0.1481 | 0.0157 | 0.3871 | 0.29 | 6lvb:C, 6lvb:E, 6lvb:G, 6lvc:A, 6lvc:C, 6lvv:A, 6lvv:C, 6lvv:E, 6lvv:G, 6lvv:I, 6lvv:K, 6lvv:M, 6lvv:O, 7w8j:A, 7w8j:C, 7w8j:E, 7w8j:G |
3 | 4r83:A | 474 | 51 | 0.1605 | 0.0274 | 0.2549 | 1.1 | 4r83:B, 4r83:C, 4r83:D, 4r84:A, 4r84:B, 4r84:C, 4r84:D, 4r9v:A |
4 | 4s3q:A | 682 | 40 | 0.1728 | 0.0205 | 0.3500 | 2.7 | 4s3r:A |
5 | 2nvo:A | 496 | 29 | 0.1358 | 0.0222 | 0.3793 | 7.7 |