BioLiP

>protein
MFEVPITLTNRKFAQRRKLKYQYINYISRRFDRISKSDEERKFWKKYEKPEKSFEIWRTVSSQNKQPINKQKMTYHNFKK
IEKIPLRKMEIPLLHCTKENKLYFQSISRGLEPLKTSTSEVRNYRTRHIVTLTDLLHLNVSRHNWSLAYKIFATLIRIPG
VQIKSLWGIGVEILDNLSNSSSGLDFLQWMCQIYSSKSRFVQNINYRSIVPPFQTGSRTHTAKFAITYLWSSLINCQKSM
LIDKISEWVLTPPFMEDAEVWFIYASCHLLKADTLSRQFVDIKINQVIKHIHYVRTFLKICLDKGGFAVPSRLIENQLKS
FESRL

The query sequence (length=325) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6rqh:R	330	329	1.0000	0.9848	0.9878	0.0	6rql:R, 6rrd:R, 6rui:R, 6ruo:R, 6rwe:R, 6tps:R
2	5w5y:Q	349	348	1.0000	0.9312	0.9339	0.0	5w64:Q, 5w65:Q, 5w66:Q
3	5n61:R	303	323	0.8923	0.9571	0.8978	0.0
4	2n2x:B	30	28	0.0308	0.3333	0.3571	4.9
5	1sy7:A	698	93	0.0646	0.0301	0.2258	5.3	1sy7:B
6	8yhe:H	524	47	0.0431	0.0267	0.2979	5.4	8yhd:H
7	8z9e:H	553	47	0.0431	0.0253	0.2979	6.5
8	8z99:H	582	47	0.0431	0.0241	0.2979	7.1	8yhd:I, 8yhd:L, 8yhe:I, 8yhe:L, 8z4j:H, 8z4j:I, 8z4j:L, 8z4l:H, 8z4l:I, 8z4l:L, 8z99:I, 8z99:L, 8z9c:H, 8z9c:I, 8z9c:L, 8z9e:I, 8z9e:L
9	7ccf:A	405	67	0.0677	0.0543	0.3284	7.3	5gwe:A, 5gwe:B, 5gwe:C, 5gwe:D, 5xjn:A
10	8qa6:A	553	58	0.0523	0.0307	0.2931	9.6	8qa6:B
11	7xhn:K	230	87	0.0862	0.1217	0.3218	9.6	7xho:K

[Back]