BioLiP

>protein
MEVNQLGLIATALFVLVPSVFLIILYVQTESQQ

The query sequence (length=33) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3a0b:M	36	33	0.9697	0.8889	0.9697	2.29e-16	3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M
2	8wql:MD	36	33	0.6970	0.6389	0.6970	1.13e-11	8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE
3	8bd3:m	57	32	0.6667	0.3860	0.6875	2.60e-10
4	5xnl:M	33	33	0.6667	0.6667	0.6667	8.61e-10	7oui:M, 7oui:m, 5xnl:m, 5xnm:M, 5xnm:m
5	7ymi:M	31	30	0.6364	0.6774	0.7000	2.74e-09	7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M
6	7pi5:M	32	32	0.5758	0.5938	0.5938	1.22e-08	7pi5:m, 7pin:M, 7pin:m, 7pin:M1, 7pin:m1, 7piw:M, 7piw:m, 7piw:M1, 7piw:m1, 7pnk:M, 7pnk:m
7	8tow:M	31	29	0.6061	0.6452	0.6897	1.28e-08	8tow:m
8	6kac:M	30	30	0.5455	0.6000	0.6000	4.67e-07	6kac:m, 6kad:M, 6kad:m
9	4yuu:m2	40	33	0.4848	0.4000	0.4848	8.60e-04	4yuu:m1, 4yuu:M2
10	7y5e:ML	42	33	0.3939	0.3095	0.3939	0.022	7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm
11	8wb4:M	36	25	0.3333	0.3056	0.4400	0.11	8wb4:m
12	8xlp:m	38	25	0.3030	0.2632	0.4000	0.56
13	8j5k:M	41	25	0.2727	0.2195	0.3600	0.59	8j5k:m

[Back]