BioLiP

>protein
MEVNQLGLIATALFVLVPSVFLIILYVQTE

The query sequence (length=30) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	3a0b:M	36	30	0.9667	0.8056	0.9667	3.35e-14	3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M
2	8wql:MD	36	30	0.7333	0.6111	0.7333	2.22e-10	8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE
3	8bd3:m	57	29	0.6667	0.3509	0.6897	1.27e-08
4	8tow:M	31	29	0.6667	0.6452	0.6897	1.34e-08	8tow:m
5	5xnl:M	33	29	0.6667	0.6061	0.6897	2.26e-08	7oui:M, 7oui:m, 5xnl:m, 5xnm:M, 5xnm:m
6	7ymi:M	31	27	0.6667	0.6452	0.7407	3.72e-08	7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M
7	7pi5:M	32	28	0.6333	0.5938	0.6786	6.91e-08	7pi5:m, 7pin:M, 7pin:m, 7pin:M1, 7pin:m1, 7piw:M, 7piw:m, 7piw:M1, 7piw:m1, 7pnk:M, 7pnk:m
8	6kac:M	30	28	0.5667	0.5667	0.6071	3.17e-06	6kac:m, 6kad:M, 6kad:m
9	4yuu:m2	40	30	0.5333	0.4000	0.5333	0.004	4yuu:m1, 4yuu:M2
10	7y5e:ML	42	30	0.4333	0.3095	0.4333	0.18	7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm
11	8wb4:M	36	22	0.3333	0.2778	0.4545	2.5	8wb4:m
12	8j5k:M	41	22	0.3000	0.2195	0.4091	3.8	8j5k:m
13	8xlp:m	38	22	0.3333	0.2632	0.4545	3.9

[Back]