MEVNILAFIATALFILVPTAFLLIIYVKTVSQ
The query sequence (length=32) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5xnl:M | 33 | 32 | 1.0000 | 0.9697 | 1.0000 | 1.24e-15 | 7oui:M, 7oui:m, 5xnl:m, 5xnm:M, 5xnm:m |
2 | 8bd3:m | 57 | 32 | 0.7812 | 0.4386 | 0.7812 | 8.85e-12 | |
3 | 3a0b:M | 36 | 32 | 0.7188 | 0.6389 | 0.7188 | 9.90e-11 | 3a0b:m, 3a0h:M, 3a0h:m, 5b66:M, 7d1u:M, 7d1u:m, 7dxh:m, 8f4f:m, 6jln:M, 6jlo:M, 6jlp:M, 5mx2:m, 1s5l:M, 1s5l:m, 5tis:M, 5v2c:M |
4 | 7pi5:M | 32 | 31 | 0.6562 | 0.6562 | 0.6774 | 3.69e-09 | 7pi5:m, 7pin:M, 7pin:m, 7pin:M1, 7pin:m1, 7piw:M, 7piw:m, 7piw:M1, 7piw:m1, 7pnk:M, 7pnk:m |
5 | 8wql:MD | 36 | 32 | 0.5938 | 0.5278 | 0.5938 | 1.08e-08 | 8wql:ME, 8wql:M1, 8wql:m1, 8wql:mD, 8wql:mE |
6 | 6kac:M | 30 | 29 | 0.6250 | 0.6667 | 0.6897 | 9.38e-08 | 6kac:m, 6kad:M, 6kad:m |
7 | 8tow:M | 31 | 29 | 0.5625 | 0.5806 | 0.6207 | 3.36e-07 | 8tow:m |
8 | 7ymi:M | 31 | 30 | 0.4688 | 0.4839 | 0.5000 | 5.56e-05 | 7ymi:m, 7ymm:1M, 7ymm:2M, 7ymm:3M, 7ymm:4M |
9 | 7y5e:ML | 42 | 32 | 0.3750 | 0.2857 | 0.3750 | 0.071 | 7y5e:m6, 7y7a:M9, 7y7a:ME, 7y7a:mO, 7y7a:mZ, 7y7a:Mm |
10 | 4yuu:m2 | 40 | 26 | 0.2812 | 0.2250 | 0.3462 | 0.45 | 4yuu:m1, 4yuu:M2 |
11 | 8wb4:M | 36 | 30 | 0.3125 | 0.2778 | 0.3333 | 1.0 | 8wb4:m |