MEVEKEFITDEAKELLSKDKLIQQAYNEVKTSICSPIWPATSKTFTINNTEKNCNGVVPIKELCYTLLEDTYNWYREKPL
DILKLEKKKGGPIDVYKEFIENSELKRVGMEFETGNISSAHRSMNKLLLGLKHGEIDLAIILMPIKQLAYYLTDRVTNFE
ELEPYFELTEGQPFIFIGFNAEAYNSNVPLIPKGSDGMSKRSIKKWK
The query sequence (length=207) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2bam:B | 210 | 207 | 1.0000 | 0.9857 | 1.0000 | 9.44e-154 | 2bam:A, 3bam:A, 3bam:B, 1bhm:A, 1bhm:B, 1esg:A |
2 | 3odh:A | 194 | 185 | 0.3237 | 0.3454 | 0.3622 | 1.75e-29 | 3odh:B, 3odh:E, 3odh:F |
3 | 2xn2:A | 729 | 125 | 0.1449 | 0.0412 | 0.2400 | 0.66 | |
4 | 6tug:B | 415 | 78 | 0.0821 | 0.0410 | 0.2179 | 1.5 | 6tug:A, 6tug:C, 6tug:D, 6tug:E, 6tug:F, 6tug:G, 6tug:H |
5 | 6riw:A | 923 | 46 | 0.0773 | 0.0173 | 0.3478 | 3.9 | |
6 | 6fg5:A | 334 | 43 | 0.0628 | 0.0389 | 0.3023 | 6.1 | 6ezu:A, 6ezu:B, 6fg5:B |
7 | 7rxb:A | 548 | 48 | 0.0773 | 0.0292 | 0.3333 | 6.3 | 7rxb:B |
8 | 7rxg:B | 650 | 48 | 0.0773 | 0.0246 | 0.3333 | 6.8 | 7rxg:A, 7rxh:A |
9 | 7rx3:B | 591 | 48 | 0.0773 | 0.0271 | 0.3333 | 6.9 | 7rx3:A, 7rxa:A, 7rxa:B |
10 | 7rx2:B | 615 | 48 | 0.0773 | 0.0260 | 0.3333 | 7.2 | 6e0h:B, 6e0h:A, 6e1o:B, 6e1o:A, 7rwj:B, 7rwj:A, 7rx2:A |
11 | 7rhq:A | 974 | 43 | 0.0628 | 0.0133 | 0.3023 | 9.5 | 7rhr:A |