MESYLVDTYQGIPYTAAVQVDLIEKDLLPASLTIWFPLFQANTPPAVLLDQLKTLTITTLYAASQNGPILKVNASAQGAA
MSVLPKKFEVNATVALDEYSKLEFDKLTVCEVKTVYLTTMKPYGMVSVGKKTHDLIALCDFMDLEKNTPVTIPAFIKSVS
IKEQALTQAKIAPYAGLIMIMTMNNPKGAGTQVIVELGAYVQAESISKICKTWSHQGTRYVLKSR
The query sequence (length=225) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4lp7:D | 230 | 235 | 0.9733 | 0.9522 | 0.9319 | 3.45e-156 | 4lp7:A, 4lp7:B, 4lp7:C |
2 | 8bos:G | 320 | 57 | 0.0844 | 0.0594 | 0.3333 | 3.8 | 1wq1:G |
3 | 6uxw:A | 778 | 134 | 0.1422 | 0.0411 | 0.2388 | 4.8 | 7egp:A, 6iy2:O, 6iy3:O, 6uxv:A, 5x0x:O, 5x0y:O, 5z3l:O, 5z3o:O, 5z3u:O, 5z3v:O |
4 | 7v6d:A | 367 | 106 | 0.1111 | 0.0681 | 0.2358 | 9.6 | 7v6d:B |