MERNKLARQIIDTCLEMTRLGLNQGAAGNVSVRYQDGMLITPTGIPYEKLTESHIVFIDGNGKHEEGKLPSSEWRFHMAA
YQSRPDANAVVHNHAVHCTAVSILNRSIPAIHYMIAAAGGNSIPCAPYATFGTRELSEHVALALKNRKATLLQHHGLIAC
EVNLEKALWLAHEVEVLAQLYLTTLAITDPVPVLSDEEIAVVLEKFKTY
The query sequence (length=209) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2fua:A | 210 | 209 | 0.9952 | 0.9905 | 0.9952 | 3.05e-157 | 1dzu:P, 1dzv:P, 1dzw:P, 1dzx:P, 1dzy:P, 1dzz:P, 1e46:P, 1e47:P, 1e48:P, 1e49:P, 1e4a:P, 1e4b:P, 1e4c:P, 1fua:A, 3fua:A, 4fua:A, 7x78:A |
2 | 4c25:A | 212 | 210 | 0.4067 | 0.4009 | 0.4048 | 4.97e-47 | 4c24:A |
3 | 6btg:A | 207 | 206 | 0.3541 | 0.3575 | 0.3592 | 6.49e-39 | 6btd:A |
4 | 6voq:A | 207 | 190 | 0.2632 | 0.2657 | 0.2895 | 3.86e-15 | |
5 | 4xxf:A | 249 | 215 | 0.2344 | 0.1968 | 0.2279 | 5.25e-11 | |
6 | 1jdi:A | 223 | 124 | 0.1914 | 0.1794 | 0.3226 | 3.23e-09 | 1jdi:B, 1jdi:C, 1jdi:D, 1jdi:E, 1jdi:F, 1k0w:A, 1k0w:B, 1k0w:C, 1k0w:D, 1k0w:E, 1k0w:F |
7 | 8il8:A | 230 | 179 | 0.1962 | 0.1783 | 0.2291 | 3.16e-08 | 8il8:B, 8il8:C, 8il8:D |
8 | 4m6r:A | 224 | 110 | 0.1388 | 0.1295 | 0.2636 | 8.80e-06 | 4m6r:B, 4m6r:C, 4m6r:D |
9 | 2z7b:A | 237 | 208 | 0.1962 | 0.1730 | 0.1971 | 0.021 | |
10 | 6ihv:A | 221 | 72 | 0.0909 | 0.0860 | 0.2639 | 2.7 | 6ihu:A |
11 | 7t1q:A | 377 | 58 | 0.0957 | 0.0531 | 0.3448 | 2.7 | 8f8o:A, 8f8o:B, 7t1q:B |
12 | 6ihr:A | 257 | 72 | 0.0909 | 0.0739 | 0.2639 | 4.3 | 5f1m:A, 6ihl:A, 6ihs:A, 6iht:A, 6ihw:A |
13 | 5csl:B | 2072 | 17 | 0.0478 | 0.0048 | 0.5882 | 5.6 | 5ctb:A, 5ctb:C, 5ctc:A, 5ctc:B, 5ctc:C, 5cte:B, 5cte:C, 3h0s:A, 3k8x:A, 3k8x:B, 3k8x:C, 1od2:A, 1od2:B, 3pgq:A, 3pgq:C, 3tv5:A, 3tv5:B, 3tv5:C, 3tvu:A, 3tvu:B, 3tvu:C, 3tvw:A, 3tvw:B, 3tvw:C, 3tz3:A, 3tz3:B, 3tz3:C, 1w96:A, 1w96:B, 1w96:C, 4wyo:B, 4wyo:C, 4wz8:B, 4wz8:C |
14 | 5csl:A | 2050 | 17 | 0.0478 | 0.0049 | 0.5882 | 5.6 | |
15 | 3kgd:B | 342 | 77 | 0.1148 | 0.0702 | 0.3117 | 7.2 | 3kgd:A, 3kgd:C, 3kgd:D, 1qmh:B, 3tut:A, 3tux:A, 3tv1:A, 3tv1:B, 3tw3:A |