BioLiP

>protein
MERAEILGVGTELLYGETLDTNTAEIARSLKPYALKVERTLRVADEVAPLAREVEEAFARARLVVLSGGLGPTPDDVTRE
AVALALGEPLELDEAVLGEIEAFFRARGRAMPEANRKQAMRIPSATWLKNPRGTAPGWWVRKGGKDLVLLPGPPPEWRPM
WQEVLPRLGLPRRPYAERVLKTWGIGESEIVEVEVGTYPKVHGVEVVVRGREDRVAELAERIKKKLLKEVWGEGEMTLAE
AVKRRMEREGATLSTMESLTGGLLGAEITRVPGASRFYLGGVVSYSVGAKARFGVPQDLLSRTVSAETARAMAEAARSLF
GSTYALATTGVAGPDPLEGEPPGTVYVALAGPTGAEVRRYRFPGDRETVRLRSVYAALALLVT

The query sequence (length=383) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	4ct9:A	394	394	1.0000	0.9721	0.9721	0.0	4cta:A, 4cta:B, 4uoc:A, 4uoc:B, 4uuw:A, 4uux:A, 4uux:B
2	1pg8:A	398	162	0.1044	0.1005	0.2469	0.47	7f1u:A, 7f1u:B, 7f1u:C, 7f1u:D, 7f1v:A, 7f1v:B, 7f1v:C, 7f1v:D, 1pg8:C, 1pg8:B, 1pg8:D, 3vk3:A, 3vk3:B, 3vk3:C, 3vk3:D, 5x2w:A, 5x2w:B, 5x2w:C, 5x2w:D, 5x2x:A, 5x2x:B, 5x2x:C, 5x2x:D, 5x2z:A, 5x2z:B, 5x2z:C, 5x2z:D, 5x30:A, 5x30:B, 5x30:C, 5x30:D
3	4nic:A	117	93	0.0757	0.2479	0.3118	1.6	4nic:B, 4nic:C, 4nic:D
4	2fts:A	419	82	0.0470	0.0430	0.2195	2.9	5err:A, 5ers:A, 5ert:A, 5eru:A, 5erv:A, 6fgc:A, 6fgd:A, 6hsn:A, 6hso:A, 4pd1:A, 1t3e:B, 4tk1:A, 4tk1:B, 4tk2:B, 4tk2:A, 4tk3:B, 4tk3:A, 4tk4:B, 4tk4:A, 4u90:A, 4u91:A
5	3fhm:A	136	79	0.0601	0.1691	0.2911	3.1	3fhm:D, 3fhm:B, 3fhm:C
6	3ab8:A	261	34	0.0496	0.0728	0.5588	3.1	3ab8:B
7	5cd1:B	321	71	0.0574	0.0685	0.3099	7.3
8	1wl4:A	394	63	0.0574	0.0558	0.3492	9.0

[Back]