MENPHEQVQANILSRIIGNVKRLNESVAILNQELVTINNRNKNLEIMGAICDNYHSSVQFNLEATNNKKPPL
The query sequence (length=72) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q84:Y | 72 | 72 | 1.0000 | 1.0000 | 1.0000 | 1.12e-47 | |
2 | 7pub:CE | 426 | 17 | 0.1250 | 0.0211 | 0.5294 | 5.6 | 7aor:a, 6hiv:CE, 6hiw:CE, 6hiy:CE, 7pua:CE, 6sga:CE, 6sgb:CE |
3 | 9f1t:A | 477 | 52 | 0.1806 | 0.0273 | 0.2500 | 6.5 | 9f1t:B, 9f3z:B, 9f3z:A |
4 | 8hnw:A | 809 | 76 | 0.2361 | 0.0210 | 0.2237 | 7.7 | |
5 | 7pua:F5 | 620 | 67 | 0.2361 | 0.0274 | 0.2537 | 9.7 |