BioLiP

>protein
MELYNIKYAIDPTNKIVIEQVDNVDAFVHILEPGQEVFDETLSQYHQFPGVVSSIIFPQLVLNTIISVLSEDGSLLTLKL
ENTCFNFHVCNKRFVFGNLPAAVVNNETKQKLRIGAPIFAGKKLVSVVTAFHRVGENEWLLPVTGIREASQLSGHMKVLN
GVRVEKWRPNMSVYGTVQLPYDKIKQHALEQLESCVLFYKDSEIRITYNKGDYEIMHLRMPGPLIQ

The query sequence (length=226) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	6xb3:A	234	233	1.0000	0.9658	0.9700	4.52e-168	6xb3:B, 6xb3:C, 6xb3:D, 6xb3:E, 6xb3:F, 6xb3:G, 6xb3:H, 6xb3:I, 6xb3:J, 6xb3:K, 6xb3:L, 6xb3:M, 6xb3:N, 6xb3:O, 6xb3:P
2	6ea8:A	195	156	0.1947	0.2256	0.2821	0.011	6ea8:B, 6ea8:E, 6ea8:F, 6ea8:G, 6ea8:H, 6ea9:A, 6ea9:B, 6ea9:C, 6ea9:D, 6ea9:E, 8orv:A, 8p44:A, 8p44:B, 8p44:C, 8p44:D
3	8acc:A	231	52	0.0885	0.0866	0.3846	2.5
4	4eu5:A	513	94	0.1062	0.0468	0.2553	4.0	5ddk:A, 5ddk:B, 5dw4:B, 5dw4:A, 5dw5:A, 5dw5:B, 5dw6:A, 5dw6:B, 5e5h:A, 5e5h:B, 4eu3:B, 4eu4:A, 4eu4:B, 4eu5:B, 4eu6:A, 4eu6:B, 4eu7:A, 4eu7:B, 4eu8:A, 4eu8:B, 4eu9:A, 4eu9:B, 4eua:A, 4eua:B, 4eub:A, 4eub:B, 4euc:A, 4euc:B, 4eud:A, 4eud:B
5	1r6v:A	671	47	0.0752	0.0253	0.3617	5.0
6	6xyw:Ac	218	83	0.0885	0.0917	0.2410	5.3
7	6bhn:A	156	55	0.0664	0.0962	0.2727	6.8	6bho:A
8	3w2z:A	178	30	0.0487	0.0618	0.3667	6.8	5zoh:A
9	6c9h:B	168	70	0.0796	0.1071	0.2571	7.6	6e4t:B, 6e4u:B, 6e4w:B, 5kq5:B, 4qfr:B, 4qfs:B, 5t5t:B, 5ufu:B
10	6vfr:A	428	64	0.0973	0.0514	0.3438	8.3	6vfr:B

[Back]