MELTLYNGEKKTFYSRPNNHDNCWLNAILQLFRYVEEPFFDWVYSSPENLTLEAIKQLEDLTGLELHEGGPPALVIWNIK
HLLHTGIGTASRPSEVCVVDGTDMCLADFHAGIFLKGQEHAVFACVTSNGWYAIDDEDFYPWTPDPSDVLVFVPYDQ
The query sequence (length=157) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4qbb:A | 159 | 157 | 1.0000 | 0.9874 | 1.0000 | 8.92e-118 | 4qbb:B, 4qbb:C |
2 | 7od3:A | 1012 | 30 | 0.0701 | 0.0109 | 0.3667 | 3.8 | 7od3:B, 7od3:C |
3 | 5u7x:F | 412 | 56 | 0.0892 | 0.0340 | 0.2500 | 4.5 | |
4 | 4hxg:F | 614 | 50 | 0.1083 | 0.0277 | 0.3400 | 4.7 | 4hxe:B, 4hxf:B, 4hxg:A, 4hxg:B, 4hxg:C, 4hxg:D, 4hxg:E, 4hxg:G, 4hxg:H, 4hxg:I, 4hxg:L |
5 | 6r5k:A | 1040 | 19 | 0.0637 | 0.0096 | 0.5263 | 6.8 | 4q8h:A, 6r9m:A, 6r9p:A, 6r9q:A |
6 | 6r9j:A | 595 | 19 | 0.0637 | 0.0168 | 0.5263 | 7.0 | 6r9o:A |
7 | 4q8g:B | 353 | 19 | 0.0637 | 0.0283 | 0.5263 | 7.8 | 4q8g:A |