MELHILEHRVRVLSVARPGLWLYTHPLIKLLFLPRRSRCKFFSLTETPEDYTLMVDEEGFKELPPSEFLQVAEATWLVLN
The query sequence (length=296) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
5gt7:C |
318 |
318 |
0.9932 |
0.9245 |
0.9245 |
0.0 |
5gs9:A, 5gt7:A, 5gt7:D, 5i2c:A |
2 |
5gv2:C |
307 |
299 |
0.9831 |
0.9479 |
0.9732 |
0.0 |
5gs9:B, 5gs9:C, 5gs9:D, 5gt7:B, 5gv2:A, 5i2c:B, 5i2c:C, 5i2c:D |
3 |
5g2v:A |
494 |
56 |
0.0541 |
0.0324 |
0.2857 |
6.5 |
|
4 |
1sk8:A |
435 |
53 |
0.0608 |
0.0414 |
0.3396 |
7.6 |
1sk9:A |
5 |
6ln0:A |
425 |
71 |
0.0642 |
0.0447 |
0.2676 |
8.0 |
|
6 |
8g1e:A |
1037 |
89 |
0.0676 |
0.0193 |
0.2247 |
8.4 |
8g1e:B, 8g1e:D, 8g1e:C, 8g1f:A, 8g1f:C, 8g1f:B, 8g1f:D, 8g5c:A, 8g5c:B, 8g5c:C, 8g5c:D, 8g5d:A, 8g5d:B, 8g5d:C, 8g5d:D, 6hxh:A, 6hxh:B, 6hxh:C, 6hxh:D, 6hxh:E, 6hxh:F, 6hxh:G, 6hxh:H, 6hxk:A, 6hxk:B, 6hxk:C, 6hxk:D, 6hxl:A, 6hxl:B, 6hxl:C, 6hxl:D, 6hxl:E, 6hxl:F, 6hxl:G, 6hxl:H, 6hxm:A, 6hxm:B, 7liw:B, 7liw:D, 7lj9:A, 7lj9:B, 7lj9:C, 7lj9:D, 7lla:A, 7lla:C, 7lla:B, 7lla:D, 3mwe:A, 6o0h:A, 6o0h:B, 6o0h:C, 6o0h:D, 3pff:A, 6poe:B, 6poe:D, 6poe:A, 6poe:C, 6qfb:A, 6qfb:B, 6qfb:D, 7rig:A, 7rig:C, 7rig:B, 7rig:D, 7rkz:A, 7rkz:C, 7rkz:B, 7rkz:D, 7rmp:A, 7rmp:C, 7rmp:B, 7rmp:D, 5tde:A, 5tde:B, 5tdf:A, 5tdm:A, 5tdm:B, 5tdz:A, 5te1:A, 5te1:B, 5teq:A, 5teq:B, 5tes:A, 5tet:A, 6ui9:A, 6ui9:C, 6ui9:B, 6ui9:D, 6uia:C, 6uia:A, 6uia:D, 6uia:B, 6uuw:A, 6uuw:C, 6uuw:B, 6uuw:D, 6uuz:A, 6uuz:C, 6uuz:B, 6uuz:D, 6uv5:A, 6uv5:C, 6uv5:B, 6uv5:D, 6z2h:A, 6z2h:C, 6z2h:D |
7 |
7es1:A |
408 |
51 |
0.0642 |
0.0466 |
0.3725 |
9.4 |
7erx:A, 7es0:A, 7es2:A |
8 |
3c1m:C |
468 |
52 |
0.0507 |
0.0321 |
0.2885 |
9.6 |
3c1m:A, 3c1m:B, 3c1m:D, 3c1n:A, 3c1n:B, 3c1n:C, 3c1n:D, 3c20:A, 3c20:B, 2hmf:A, 2hmf:B, 2hmf:C, 2hmf:D |