MELHFNLELVETYKSNSQKARILTEDWVYRQSYCPNCGNNPLNHFEVADFYCNHCSEEFELKSKKGNFSSTINDGAYATM
MKRVQADNNPNFFFLTYTKNFEVNNFLVLPKQFVTPKSIIQRKPWIGCNIDLSQVPSKGRIFLVQDGQVRDPEKVTKEFK
QGLFLRKSSLSSRGWTIEILNCIDKIEGSEFTLEDMYRFESDLKNIFVKNNHIKEKIRQQLQILRDKEIIEFKGRGKYRK
L
The query sequence (length=241) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4kyw:A | 254 | 254 | 1.0000 | 0.9488 | 0.9488 | 3.88e-177 | 4esj:A, 4esj:B |
2 | 4afy:B | 250 | 75 | 0.0705 | 0.0680 | 0.2267 | 1.6 | 4afy:A, 4ag0:A, 4ag0:B, 3hv8:A |
3 | 6agg:Z | 420 | 56 | 0.0747 | 0.0429 | 0.3214 | 1.6 | 3amt:A, 3amu:A, 3au7:A, 4rvz:Z, 5xob:Z |
4 | 4v9f:Z | 83 | 32 | 0.0415 | 0.1205 | 0.3125 | 7.0 | 3cc2:Z, 3cc4:Z, 3cc7:Z, 3cce:Z, 3ccj:Z, 3ccl:Z, 3ccm:Z, 3ccq:Z, 3ccr:Z, 3ccs:Z, 3ccu:Z, 3ccv:Z, 3cd6:Z, 3cma:Z, 3cme:Z, 3cpw:Y, 3g4s:Z, 3g6e:Z, 3g71:Z, 3i55:Z, 3i56:Z, 2otj:Z, 2otl:Z, 2qa4:Z, 2qex:Z, 1s72:Z, 1vq4:Z, 1vq5:Z, 1vq6:Z, 1vq7:Z, 1vq8:Z, 1vq9:Z, 1vqk:Z, 1vql:Z, 1vqm:Z, 1vqn:Z, 1vqo:Z, 1vqp:Z, 1yhq:Z, 1yi2:Z, 1yij:Z, 1yit:Z, 1yj9:Z, 1yjn:Z, 1yjw:Z |
5 | 6jl2:A | 401 | 49 | 0.0622 | 0.0374 | 0.3061 | 7.3 | 6jkz:A, 6jl2:B, 6jl2:C |
6 | 8hr5:A | 466 | 54 | 0.0581 | 0.0300 | 0.2593 | 7.7 | |
7 | 8j12:A | 424 | 56 | 0.0622 | 0.0354 | 0.2679 | 8.5 | 8dzj:A, 8dzj:B, 8j1j:A, 8j3r:A, 7wju:A, 7wju:B |