MEKSVSVILLAGGSMPKQYIPLLGQPIALYSFFTFSRMPEVKEIVVVCDPFFRDIFEEYEESIDVDLRFAIPGKERQDSV
YSGLQEIDVNSELVCIHDSARPLVNTEDVEKVLKDGSAVGAAVLGVPAKATIKEVNSDSLVVTLWEMQTPQVIKPELLKK
GFELVKSEGLEVTDVSIVEYLKHPVYVSQGSYTNIKVTTPDDLLLAERILSE
The query sequence (length=212) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2yc3:A | 219 | 219 | 0.9858 | 0.9543 | 0.9543 | 4.24e-147 | 5mrm:A, 5mro:A, 5mrp:A, 4nak:A, 4nal:A, 4nan:A, 1w77:A, 2yc5:A, 2ycm:A |
2 | 5hs2:A | 226 | 203 | 0.3349 | 0.3142 | 0.3498 | 1.75e-32 | |
3 | 4zdq:A | 230 | 220 | 0.3255 | 0.3000 | 0.3136 | 6.71e-25 | 4zdq:D |
4 | 1i52:A | 225 | 212 | 0.3302 | 0.3111 | 0.3302 | 1.49e-21 | 1h3m:A, 1h3m:B, 1ini:A |
5 | 2xwl:B | 222 | 209 | 0.2877 | 0.2748 | 0.2919 | 3.84e-16 | 2xwl:A, 2xwm:A, 2xwm:B |
6 | 1vpa:A | 221 | 220 | 0.3019 | 0.2896 | 0.2909 | 5.40e-14 | 1vpa:B |
7 | 6xhq:A | 237 | 228 | 0.2594 | 0.2321 | 0.2412 | 2.23e-10 | 6xhq:B, 6xhs:B, 6xhs:E, 6xht:A, 6xht:B, 6xht:E, 6xht:F |
8 | 2vsi:B | 227 | 224 | 0.2736 | 0.2555 | 0.2589 | 5.97e-10 | 2vsi:A |
9 | 4cvh:A | 391 | 233 | 0.2736 | 0.1483 | 0.2489 | 2.61e-09 | |
10 | 2xwn:B | 227 | 154 | 0.2406 | 0.2247 | 0.3312 | 9.41e-09 | 3okr:D, 3q7u:A, 3q7u:B, 3q80:A, 3q80:B, 2xwn:A |
11 | 1w55:A | 369 | 209 | 0.2547 | 0.1463 | 0.2584 | 2.25e-07 | 1w57:A |
12 | 3qtm:A | 329 | 61 | 0.1038 | 0.0669 | 0.3607 | 0.51 | 3qtm:B |
13 | 2aiz:P | 134 | 44 | 0.0660 | 0.1045 | 0.3182 | 1.5 | |
14 | 7s04:A | 396 | 44 | 0.0708 | 0.0379 | 0.3409 | 1.6 | |
15 | 1j6w:A | 161 | 127 | 0.1415 | 0.1863 | 0.2362 | 2.8 | 1j6w:B, 1joe:A, 1joe:B, 1joe:C, 1joe:D |
16 | 1guz:A | 305 | 52 | 0.0802 | 0.0557 | 0.3269 | 5.1 | 1guz:B, 1guz:C, 1guz:D |
17 | 8adg:A | 787 | 144 | 0.1651 | 0.0445 | 0.2431 | 5.2 | 8adi:A, 8bvq:A, 6lyq:A, 6lyr:A, 7nre:A, 7nrf:A, 7nri:A, 7p1c:A, 8pzu:A, 8pzv:A, 2qdf:A, 6qgw:A, 6qgx:A, 6qgy:C, 7r1w:A, 7tsz:A, 7tt0:A, 7tt1:A, 7tt2:A, 7tt3:A, 7tt4:A, 7ttc:A |
18 | 8ow6:A | 149 | 64 | 0.0896 | 0.1275 | 0.2969 | 6.2 | 8ow6:C |
19 | 8c3a:H | 206 | 29 | 0.0660 | 0.0680 | 0.4828 | 8.2 | 8c3a:CS, 8cq7:H, 8cq7:CS, 8cqw:H, 8cqw:CS, 8cre:H, 8cre:CS, 8oeq:H, 8oeq:CS, 7pzy:G, 7q08:G, 7q0f:G, 7q0p:G, 7q0r:G, 8q5i:G |