BioLiP

>protein
MEFDYVICEECGKEFMDSYLMNHFDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKDMKLYLKLQ
IVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVR

The query sequence (length=126) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	8ebt:K	172	130	0.9683	0.7093	0.9385	2.36e-82	7ad8:G, 8ebu:K, 8ebx:K, 8eby:K, 6j44:A, 6lae:A, 6lae:B, 6ro4:G, 1xpa:A
2	5a39:B	115	101	0.2381	0.2609	0.2970	1.23e-07	5a39:A, 5a3d:A, 5a3d:B, 5g32:A, 5g32:B, 5g33:A, 5g33:B, 5g34:A, 5g34:B, 5g35:A, 5g35:B, 5lcl:A, 5lcl:B, 5lcm:A, 5lcm:B
3	4ddt:A	1102	96	0.2143	0.0245	0.2812	0.70	4ddu:A, 4ddv:A, 4ddv:B, 4ddw:A, 4ddx:A, 4ddx:B, 7fsf:A
4	6sw9:C	61	30	0.0714	0.1475	0.3000	1.1	6swc:C, 6swd:C, 7zag:C, 7zah:C, 7zai:C, 7zhg:C
5	6tmf:W	56	28	0.0794	0.1786	0.3571	1.1	6skf:Az, 6skg:Az, 6th6:Az
6	8txo:J	1162	125	0.2540	0.0275	0.2560	1.4
7	6rxt:CM	445	46	0.1270	0.0360	0.3478	1.8	5oql:d, 6rxu:CM, 6rxv:CM, 6rxx:CM, 6rxy:CM, 6rxz:CM
8	8sy7:J	1052	125	0.2540	0.0304	0.2560	2.0	8sy5:J
9	2ytt:A	46	18	0.0794	0.2174	0.5556	3.7
10	5j7i:B	456	46	0.1429	0.0395	0.3913	3.8	5j7i:C, 5j7i:D
11	2epr:A	48	21	0.0873	0.2292	0.5238	4.7
12	5v3g:D	170	62	0.1429	0.1059	0.2903	5.3	5egb:A, 5eh2:F, 5eh2:E, 5ei9:E, 5ei9:F, 5v3g:A

[Back]