BioLiP

>protein
MEERAAMDAVCAKVDAANRLGDPLEAFPVFKKYDRNGLNVSIECKRVSGLEPATVDWAFDLTKTNMQTMYEQSEWGWKDR
EKREEMTDDRAWYLIAWENSSVPVAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQILQLMANSTQMKKVMLTV
FKHNHGAYQFFREALQFEIDDSSPSCSYEILSRRTKF

The query sequence (length=197) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7kd7:A	204	204	0.9949	0.9608	0.9608	3.85e-146	7kd7:D, 7kpu:D, 7kpu:A, 4u9v:B, 4u9w:B, 4u9w:A, 4u9w:C, 4u9w:D
2	4ua3:B	193	147	0.2538	0.2591	0.3401	1.77e-21	4ua3:A
3	3ld2:B	162	61	0.0914	0.1111	0.2951	0.24	3ld2:A, 3ld2:C, 3ld2:D
4	5ebz:A	655	55	0.0660	0.0198	0.2364	1.0	5ebz:B, 5ebz:C, 5ebz:D, 5ebz:E, 5ebz:F, 5ebz:G, 5ebz:H, 5ebz:L, 5ebz:I, 5ebz:K, 5ebz:J
5	2z86:C	603	76	0.0964	0.0315	0.2500	2.2	2z86:A, 2z86:B, 2z86:D, 2z87:A, 2z87:B
6	6ogz:A	1082	75	0.0863	0.0157	0.2267	2.3	6ogy:A, 6oj6:P, 2r7r:A, 2r7s:A, 2r7t:A, 2r7u:A, 2r7v:A, 2r7w:A, 2r7x:A, 2r7x:B
7	6azq:G	226	58	0.0711	0.0619	0.2414	2.4	6azq:H, 6azq:A, 6azq:B, 6azq:C, 6azq:D, 6azq:E, 6azs:B, 6azs:D
8	7m7f:A	1390	32	0.0761	0.0108	0.4688	2.7	2fr0:A, 2fr1:A, 7m7i:A
9	6bvc:A	154	72	0.0812	0.1039	0.2222	3.6	1bo4:A, 1bo4:B
10	7cgv:A	310	18	0.0508	0.0323	0.5556	6.3	7cgv:B, 7cgv:C, 7cgv:D
11	1tiq:A	173	59	0.0812	0.0925	0.2712	7.5	1tiq:B
12	4xpl:A	141	71	0.1015	0.1418	0.2817	7.8

[Back]