MEDLIDGIIFAANYLGSTQLLSDKTPSKNVRMMQAQEAVSRIKMAQKLMTEVDLFILTQRIKVLNADTQETMMDHPLRTI
SYIADIGNIVVLMARRRYKMICHVFESEDAQLIAQSIGQAFSVAYQEFLR
The query sequence (length=130) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1x11:A | 135 | 133 | 0.9769 | 0.9407 | 0.9549 | 4.57e-88 | 1aqc:B, 1x11:B |
2 | 3sv1:A | 163 | 139 | 0.9000 | 0.7178 | 0.8417 | 1.79e-81 | 1aqc:A, 3sv1:B, 3sv1:C |
3 | 6itu:A | 146 | 135 | 0.3308 | 0.2945 | 0.3185 | 2.11e-09 | |
4 | 8ym2:A | 149 | 129 | 0.3000 | 0.2617 | 0.3023 | 1.21e-04 | |
5 | 1shc:A | 195 | 86 | 0.1692 | 0.1128 | 0.2558 | 1.50e-04 | 2l1c:A |
6 | 3so6:A | 137 | 130 | 0.2154 | 0.2044 | 0.2154 | 0.035 | |
7 | 7ob9:A | 1535 | 40 | 0.1077 | 0.0091 | 0.3500 | 2.0 | 7oba:A |
8 | 7vbc:A | 1477 | 40 | 0.1077 | 0.0095 | 0.3500 | 2.2 | 7vba:A, 7vbb:A |
9 | 7obb:A | 1510 | 40 | 0.1077 | 0.0093 | 0.3500 | 2.2 | |
10 | 1eg4:A | 260 | 47 | 0.1231 | 0.0615 | 0.3404 | 3.3 | |
11 | 5y6p:dy | 303 | 64 | 0.1385 | 0.0594 | 0.2812 | 7.8 | 5y6p:dz |
12 | 5o9c:A | 348 | 35 | 0.0923 | 0.0345 | 0.3429 | 8.1 | 5o9c:D, 5o9c:B |
13 | 6ovf:A | 154 | 82 | 0.1462 | 0.1234 | 0.2317 | 9.1 | 1m7e:A, 1m7e:B, 1m7e:C, 6o5o:A, 6o5o:B, 6ovf:B |