MEDILARHRKENKDLQNKITGMKKQATKSKRKEVNSKCLDLQDKLKTKQENEIRDWKIANVTPEKLLEQLSNRQKERLAK
RDAAIAKMKEEAALEASKQPDLKKMEQESIDQLCELKKLKQFDIQPDGHSLFASILDQLKLRHDPKKLDQDMDVMKLRWL
SCNYVQEHRDDFIPYLFDEETMKMKDIDEYTKEMEHTAQWGGEIEILALSHVFDCPISILMSGRPIQVYNECGKNPELKL
VYYKHSYALGEHYNSLHDS
The query sequence (length=259) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8c83:x | 259 | 259 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8cah:G, 8cas:x, 8cbj:K |
2 | 6tmi:B | 246 | 64 | 0.0849 | 0.0894 | 0.3438 | 0.34 | |
3 | 7cf9:A | 3949 | 105 | 0.0965 | 0.0063 | 0.2381 | 0.44 | 7cf9:C, 7cf9:E, 7cf9:G, 8dtb:G, 8dtb:D, 6m2w:A, 6m2w:D, 6m2w:G, 6m2w:J |
4 | 4mlp:C | 492 | 181 | 0.1660 | 0.0874 | 0.2376 | 0.55 | 7ej9:A, 7ej9:B, 4i6g:A, 4i6g:B, 6kx8:A, 6kx8:B, 4mlp:A, 4mlp:B, 4mlp:D, 4u8h:A, 4u8h:C, 7v8y:A, 7v8z:A |
5 | 4bos:A | 164 | 44 | 0.0579 | 0.0915 | 0.3409 | 0.64 | |
6 | 4cej:B | 1156 | 90 | 0.0927 | 0.0208 | 0.2667 | 4.7 | 4ceh:B, 4cei:B, 3u44:B, 3u4q:B |
7 | 5jze:A | 159 | 58 | 0.0656 | 0.1069 | 0.2931 | 4.9 | 5jze:C |
8 | 8ki8:A | 1621 | 70 | 0.0695 | 0.0111 | 0.2571 | 4.9 | |
9 | 8ki7:A | 2003 | 70 | 0.0695 | 0.0090 | 0.2571 | 5.6 | |
10 | 8e9h:G | 782 | 59 | 0.0656 | 0.0217 | 0.2881 | 5.7 | 8e9g:G, 8e9i:G |
11 | 3abo:A | 453 | 108 | 0.1004 | 0.0574 | 0.2407 | 6.1 | 3abo:C, 3abq:A, 3abq:C, 3abr:A, 3abr:C, 3abs:A, 3abs:C, 3any:A, 3any:C, 3ao0:A, 3ao0:C, 7xrm:A, 7xrm:C, 7xrn:A, 7xrn:C, 5ysn:A, 5ysn:C, 5ysr:A, 5ysr:C |
12 | 7stm:A | 801 | 54 | 0.0579 | 0.0187 | 0.2778 | 7.0 | 7stm:B, 7stn:A, 7stn:B, 7sto:B, 7sto:A |
13 | 5anr:A | 245 | 22 | 0.0386 | 0.0408 | 0.4545 | 8.2 | |
14 | 7t65:A | 4252 | 112 | 0.1004 | 0.0061 | 0.2321 | 8.8 | 7t64:A, 7t64:B, 7t64:C, 7t64:D, 7t65:B, 7t65:C, 7t65:D |
15 | 7tzc:A | 4404 | 112 | 0.1004 | 0.0059 | 0.2321 | 8.8 | 3rqr:A, 8sen:A, 8sen:B, 8sen:C, 8sen:D, 8seo:A, 8seo:B, 8seo:C, 8seo:D, 8sep:A, 8sep:B, 8sep:C, 8sep:D, 8seq:A, 8seq:B, 8seq:C, 8seq:D, 8ser:A, 8ser:B, 8ser:C, 8ser:D, 8ses:A, 8ses:B, 8ses:C, 8ses:D, 8set:A, 8set:B, 8set:C, 8set:D, 7tzc:B, 7tzc:G, 7tzc:I |
16 | 7dvq:3 | 1193 | 47 | 0.0541 | 0.0117 | 0.2979 | 8.9 | |
17 | 7sqc:1A | 1639 | 62 | 0.0772 | 0.0122 | 0.3226 | 8.9 | |
18 | 7sqc:1B | 1660 | 62 | 0.0772 | 0.0120 | 0.3226 | 8.9 | |
19 | 7sqc:1C | 1700 | 62 | 0.0772 | 0.0118 | 0.3226 | 8.9 | 7sqc:1D |