MDVFVLDTSVFTNPEIYRTFEEDQRGAMETFIHLALNSRAEFYMPTSVYTEMRKIMDVGELWAEFEMVVKIRSPRRFQLT
VPADFLYEFIEELRYRINKGLRIAEEHTREASGSEDVGKLIARLREKYREALRQGILDSKEDVDVLLLAYELDGVLVSAD
EGLRTWADKIGIKLIDPKNFKNILESLV
The query sequence (length=188) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8kd9:C | 189 | 187 | 0.9947 | 0.9894 | 1.0000 | 3.39e-136 | 8kd9:E, 8kd9:G, 8kd9:H, 8kd9:D, 8kd9:F, 8kd9:J, 8kd9:I, 8kd9:A |
2 | 8kda:E | 189 | 189 | 0.6915 | 0.6878 | 0.6878 | 4.81e-94 | 8kda:G, 8kda:H, 8kda:F, 8kda:C, 8kda:D, 8kda:I, 8kda:J, 8kda:K, 8kda:A |
3 | 7e8o:A | 194 | 186 | 0.4255 | 0.4124 | 0.4301 | 1.50e-53 | 7e8o:B, 7e8o:C, 7e8o:D |
4 | 2bv3:A | 632 | 110 | 0.1702 | 0.0506 | 0.2909 | 0.11 | 1dar:A |
5 | 2lcq:A | 161 | 35 | 0.0798 | 0.0932 | 0.4286 | 0.34 | |
6 | 3f8h:A | 137 | 74 | 0.0904 | 0.1241 | 0.2297 | 0.64 | |
7 | 7q3g:A | 517 | 107 | 0.1436 | 0.0522 | 0.2523 | 3.1 | 7q3g:E, 7q3g:D, 7q3g:C, 7q3g:B |
8 | 7mq8:SB | 440 | 53 | 0.0957 | 0.0409 | 0.3396 | 3.6 | 7mq9:SB, 7mqa:SB |
9 | 6rxt:UL | 785 | 70 | 0.0957 | 0.0229 | 0.2571 | 5.4 | 6rxu:UL, 6rxv:UL, 6rxx:UL, 6rxy:UL, 6rxz:UL |
10 | 8i54:A | 1113 | 65 | 0.1011 | 0.0171 | 0.2923 | 7.8 | |
11 | 8h9d:A | 1114 | 65 | 0.1011 | 0.0171 | 0.2923 | 9.6 |