MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNS
DLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQAEPREFLQQQYRLFQTRLT
The query sequence (length=148) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4a1g:B | 149 | 147 | 0.9932 | 0.9866 | 1.0000 | 1.50e-109 | 4a1g:A, 4a1g:C, 4a1g:D |
2 | 3si5:A | 152 | 142 | 0.3716 | 0.3618 | 0.3873 | 1.18e-32 | 3si5:B |
3 | 7y7b:e | 168 | 54 | 0.1149 | 0.1012 | 0.3148 | 0.20 | |
4 | 6an0:A | 433 | 62 | 0.1284 | 0.0439 | 0.3065 | 0.80 | |
5 | 8wm6:a | 175 | 73 | 0.1486 | 0.1257 | 0.3014 | 0.84 | 8wmj:a, 8wmv:a, 8wmw:a |
6 | 8wm6:e | 169 | 54 | 0.1081 | 0.0947 | 0.2963 | 2.4 | 8wmv:e, 8wmw:e |
7 | 6kfu:A | 527 | 47 | 0.0743 | 0.0209 | 0.2340 | 2.5 | 6kfm:A, 6kfm:B, 6kfr:A, 6kfr:B |
8 | 3bo5:A | 269 | 32 | 0.0676 | 0.0372 | 0.3125 | 7.1 | |
9 | 5aza:A | 836 | 68 | 0.1284 | 0.0227 | 0.2794 | 7.1 | 5b3z:A, 5b3z:B, 5b3z:C, 5b3z:D, 2zag:A, 2zag:B, 2zag:C, 2zag:D, 2zai:A, 2zai:B, 2zai:C, 2zai:D |
10 | 5x03:B | 365 | 26 | 0.0676 | 0.0274 | 0.3846 | 7.9 | 5t4j:B, 5t4k:A, 6uxz:B, 6uxz:C, 5x03:A |
11 | 6oh9:A | 452 | 31 | 0.0811 | 0.0265 | 0.3871 | 9.8 | 6oha:A |