BioLiP

>protein
MDSFWFVQQWPPAVCSFQKSGSCPGSGLRTFTIHGLWPQQSGTSLTNCPGSPFDITKISHLQSQLNTLWPSVLRANNQQF
WSHEWTKHGTCSESTFNQAAYFKLAVDMRNNYDIIGALRPHAAGPNGRTKSRQAIKGFLKAKFGKFPGLRCRTDPQTKVS
YLVEVVACFAQDGSTLIDCTRDTCGANFIF

The query sequence (length=190) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	1v9h:A	193	190	0.9842	0.9689	0.9842	3.85e-141	1j1f:A, 1j1g:A, 1uca:A, 1ucc:A, 1ucd:A
2	1iyb:A	208	199	0.3842	0.3510	0.3668	1.28e-39	1iyb:B
3	1vcz:A	204	186	0.3421	0.3186	0.3495	3.13e-29	1vd1:A, 1vd3:A
4	1sgl:A	206	187	0.2579	0.2379	0.2620	1.02e-10
5	3d3z:A	238	141	0.2263	0.1807	0.3050	1.78e-07
6	4dw4:B	163	63	0.0842	0.0982	0.2540	1.8	4dvl:A, 4dvl:B, 4dvn:B, 4dvn:A, 4dw3:A, 4dw3:B, 4dw4:A, 4dw5:A, 4dw5:B, 4dw7:A, 4dw7:B, 4dwa:A, 4dwa:B, 4dwc:A
7	5u6k:E	191	87	0.1211	0.1204	0.2644	2.5	5u6k:A, 5u6k:B, 5u6k:C, 5u6k:D
8	8c54:A	482	88	0.1211	0.0477	0.2614	4.5	8c54:B, 8c54:C, 8c54:D
9	8thc:A	479	49	0.0737	0.0292	0.2857	4.6	8thb:A, 8thd:A
10	7vmx:A	260	40	0.0737	0.0538	0.3500	5.3
11	7xjp:B	509	31	0.0579	0.0216	0.3548	6.5
12	6d4b:A	361	43	0.0842	0.0443	0.3721	8.4	6d4b:B, 6d4c:A, 6d4c:B, 5dn9:A, 5dn9:B
13	5juy:B	1234	44	0.0684	0.0105	0.2955	9.4	1cy5:A, 3j2t:A, 3j2t:B, 3j2t:C, 3j2t:D, 3j2t:E, 3j2t:F, 3j2t:G, 3jbt:A, 3jbt:C, 3jbt:E, 3jbt:G, 3jbt:I, 3jbt:K, 3jbt:M, 5juy:A, 5juy:C, 5juy:D, 5juy:E, 5juy:F, 5juy:G, 2p1h:A, 5wve:A, 5wve:C, 5wve:E, 5wve:G, 5wve:I, 5wve:K, 5wve:M, 1z6t:A, 1z6t:B, 1z6t:C, 1z6t:D
14	6dy2:B	232	108	0.1421	0.1164	0.2500	9.5	6dy2:D

[Back]