MDREAFVQTLTACRLCPRLVAWREEVVGRKRAFRGEPYWARPVPGFGDPEARILLFGLAPGAHGSNRTGRPFTGDASGAF
LYPLLHEAGLSSKPESLPGDDLRLYGVYLTAAVRCAPPKNKPTPEELRACARWTEVELGLLPEVRVYVALGRIALEALLA
HFGLRKSAHPFRHGAHYPLPGGRHLLASYHVSRQNTQTGRLTREMFLEVLMEAKRLAGL
The query sequence (length=219) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2d3y:A | 219 | 219 | 1.0000 | 1.0000 | 1.0000 | 1.66e-159 | 2ddg:A, 2dem:A, 2dp6:A |
2 | 1l9g:A | 191 | 174 | 0.2603 | 0.2984 | 0.3276 | 1.00e-13 | 1vk2:A |
3 | 1ui0:A | 192 | 160 | 0.2283 | 0.2604 | 0.3125 | 1.53e-12 | 1ui1:A |
4 | 4zby:A | 194 | 157 | 0.2055 | 0.2320 | 0.2866 | 6.50e-12 | 4zbx:A, 4zbz:A |
5 | 5fjv:B | 207 | 30 | 0.0685 | 0.0725 | 0.5000 | 2.1 | 5fjv:A, 5fjv:E, 5fjv:C, 5fjv:D |
6 | 5h9i:A | 240 | 27 | 0.0548 | 0.0500 | 0.4444 | 3.5 | |
7 | 4n78:A | 1184 | 38 | 0.0685 | 0.0127 | 0.3947 | 4.8 | |
8 | 2d32:A | 510 | 69 | 0.0959 | 0.0412 | 0.3043 | 7.1 | 2d32:B, 2d32:C, 2d32:D, 2d33:A, 2d33:B, 2d33:C, 2d33:D, 1va6:A, 1va6:B |