MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSGEPVAYGTWCGIAGSVAFVLM
NSMQLPVIMAIAIGAVIAAMVHTTYAVTSHMGRIVSQSQFNQPLFMDMLVQHLGPIAGHGFIVTFCTVGLSYLMTLPIPG
FAHPFPLPLLAVLWGITIGAIGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG
FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEE
The query sequence (length=294) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8q3v:E | 294 | 294 | 1.0000 | 1.0000 | 1.0000 | 0.0 | 8q3v:U, 8q3v:e, 8q54:E, 8q54:e, 8q54:U |
2 | 6lqc:A | 450 | 73 | 0.0680 | 0.0444 | 0.2740 | 0.95 | 6lql:A |
3 | 7bm0:A | 427 | 79 | 0.0714 | 0.0492 | 0.2658 | 1.5 | 7blv:A, 7nxu:A |
4 | 5mln:B | 238 | 46 | 0.0510 | 0.0630 | 0.3261 | 7.3 | 5mln:A |