MDLDVITTVVKIEGKLRNETLLRVGKGKTQDFAEATDNPIIKYRDRPLIPGSSLKGAFRSLVESYTKSLNDSKYYVCDLD
DNSCVSCEEKKKIVEGRYCIPCILFGFKDLASRVYILDAIAEKYSISQRTMVAINRVFGGQMPGHLYTLDYVDPGSEFSF
MMMIYNLNLIEGEKDWKAKSVEALKFLLATLVREGIFVGARKSVGYGLIKLVDAKVSLYKAPDHLVSPVIVKKLEEVI
The query sequence (length=238) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8bmw:F | 239 | 238 | 0.9874 | 0.9833 | 0.9874 | 1.55e-172 | 8bmw:G |
2 | 8bmw:H | 275 | 238 | 0.3067 | 0.2655 | 0.3067 | 1.44e-20 | 8bmw:I |
3 | 6mur:D | 287 | 239 | 0.2773 | 0.2300 | 0.2762 | 5.35e-09 | 6iqw:C, 6iqw:D, 6mur:C, 6mus:C, 6mus:D, 6mus:K, 6mut:C, 6mut:D, 6muu:C, 6muu:D, 6o7e:C, 6o7e:D, 6o7h:C, 6o7h:D, 6o7i:C, 6o7i:D, 6o7i:K |
4 | 8x5d:K | 235 | 218 | 0.2311 | 0.2340 | 0.2523 | 1.94e-05 | 8wfx:I, 8wfx:J, 8wfx:K, 8wfx:L, 8wfx:G, 8wfx:H, 8x5d:L, 8x5d:J, 8x5d:I, 8x5d:H |
5 | 8bmw:L | 201 | 159 | 0.1723 | 0.2040 | 0.2579 | 2.18e-05 | |
6 | 8do6:E | 205 | 161 | 0.1849 | 0.2146 | 0.2733 | 3.24e-05 | 8do6:G, 8do6:F, 7uzw:A, 7uzw:B, 7uzw:C, 7uzw:D, 7uzx:A, 7uzx:B, 7uzx:C, 7uzx:D, 7uzy:D, 7uzy:C, 7uzy:A, 7uzy:B, 7uzz:D, 7uzz:C, 7uzz:A, 7uzz:B, 7v00:A, 7v00:B, 7v00:C, 7v00:D, 7v01:A, 7v01:B, 7v01:C, 7v02:A, 7v02:B, 7v02:C |
7 | 8s9u:D | 518 | 220 | 0.2605 | 0.1197 | 0.2818 | 2.48e-04 | 8s9t:D, 8s9v:D, 8s9x:D |
8 | 6ifn:F | 220 | 55 | 0.0924 | 0.1000 | 0.4000 | 0.001 | 6ifk:G, 6ifk:F, 6ifk:E, 6ifl:D, 6ifl:E, 6ifl:F, 6ifn:E, 6ifn:G, 6ifr:G, 6ifr:F, 6ifr:E, 6ifu:D, 6ifu:E, 6ifu:F, 6ify:G, 6ify:F, 6ify:E, 6ifz:G, 6ifz:F, 6ifz:E, 6ig0:G, 6ig0:F, 6ig0:E, 6nud:C, 6nud:E, 6nud:N, 6nud:O, 6nud:P, 6nue:C, 6nue:E, 6nue:N, 6nue:O, 6nue:P |
9 | 8bmw:N | 251 | 259 | 0.2605 | 0.2470 | 0.2394 | 0.002 | |
10 | 9ash:H | 214 | 178 | 0.2269 | 0.2523 | 0.3034 | 0.002 | 9ash:F, 9ash:G, 9ash:I, 9asi:F, 9asi:H, 9asi:G, 9asi:I, 6xn3:F, 6xn3:H, 6xn3:G, 6xn3:I, 6xn4:F, 6xn4:H, 6xn4:G, 6xn5:I, 6xn5:F, 6xn5:H, 6xn5:G, 6xn7:F, 6xn7:H, 6xn7:G, 6xn7:I |
11 | 4qts:C | 186 | 187 | 0.2269 | 0.2903 | 0.2888 | 0.002 | 4qts:D |
12 | 4n0l:A | 335 | 66 | 0.0966 | 0.0687 | 0.3485 | 0.013 | 4n0l:B |
13 | 6muu:F | 323 | 22 | 0.0630 | 0.0464 | 0.6818 | 0.17 | |
14 | 6o7e:Y | 361 | 22 | 0.0630 | 0.0416 | 0.6818 | 0.17 | 6o7h:F, 6o7i:F |
15 | 6mur:F | 377 | 23 | 0.0630 | 0.0398 | 0.6522 | 0.19 | 6iqw:F, 6mus:F, 6mut:F |
16 | 9ash:J | 311 | 28 | 0.0672 | 0.0514 | 0.5714 | 0.50 | 9asi:J, 6xn3:J, 6xn4:J, 6xn5:J, 6xn7:J |
17 | 6ifr:H | 353 | 25 | 0.0546 | 0.0368 | 0.5200 | 0.62 | 6ifk:H, 6ifl:H, 6ifn:H, 6ifu:H, 6ify:H, 6ifz:H, 6ig0:H |
18 | 7xss:B | 1282 | 72 | 0.1008 | 0.0187 | 0.3333 | 0.74 | 8d9f:B, 8d9h:B, 7x8a:A, 7xso:A, 7xsp:B, 7xt4:B |
19 | 7uzw:E | 184 | 165 | 0.1765 | 0.2283 | 0.2545 | 0.74 | 7uzx:E |
20 | 4dzh:A | 439 | 77 | 0.0714 | 0.0387 | 0.2208 | 1.3 | |
21 | 7y84:A | 1242 | 79 | 0.1050 | 0.0201 | 0.3165 | 1.4 | 7x7a:A, 7x7r:A, 7xc7:A, 7y83:A, 7y85:A |
22 | 7y80:A | 1218 | 79 | 0.1050 | 0.0205 | 0.3165 | 1.5 | 8gu6:A |
23 | 7y8t:A | 1298 | 81 | 0.0966 | 0.0177 | 0.2840 | 1.9 | 8d9g:B, 7xsq:A, 7xsr:B, 7y8y:A |
24 | 2w90:B | 471 | 57 | 0.0714 | 0.0361 | 0.2982 | 4.0 | 2w8z:A, 2w8z:B, 2w90:A |
25 | 7x4n:E | 332 | 62 | 0.0714 | 0.0512 | 0.2742 | 4.3 | |
26 | 8d8n:B | 1256 | 83 | 0.1008 | 0.0191 | 0.2892 | 5.1 | 8d9e:B, 8d9i:B, 7y81:A |
27 | 6s6b:J | 475 | 67 | 0.0840 | 0.0421 | 0.2985 | 5.5 | 6s8b:J, 6s8e:J, 6s91:J, 6sh8:J, 6shb:J, 6sic:J |
28 | 8of1:A | 505 | 38 | 0.0630 | 0.0297 | 0.3947 | 7.4 | 8of1:B, 8ofm:A, 8ofm:B |
29 | 8bmw:J | 270 | 92 | 0.1008 | 0.0889 | 0.2609 | 8.3 | |
30 | 8gna:A | 1188 | 76 | 0.1050 | 0.0210 | 0.3289 | 8.3 |