MDILLVCLRFPFFSVAKRSYQVRTSFLLPPPSALKGALAKGLILLKPEKYASSSLDEAALKAIKEIESKLVDIKAVSVAP
LSPLIRNAFLLKRLRNLESGSNAEKSDAMRREYTFTRELLVAYIFKNLTQEEKNLYLKAAMLIDVIGDTESLATPVWASF
VKPEDKKAPLAFSAPYTEIYSLRMYIEKMRVSPEYSQEEIFYLPIEERRYKRIVYYARIYPPEVEKALTVDGEVLGIWIP
The query sequence (length=240) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7r21:P | 240 | 240 | 1.0000 | 1.0000 | 1.0000 | 1.33e-173 | 7r2k:S, 7tr6:P, 7tr8:P, 7tr9:P, 7tra:O |
2 | 6tnn:I | 134 | 36 | 0.0542 | 0.0970 | 0.3611 | 2.7 | 6tnn:H |
3 | 7qug:A | 397 | 82 | 0.0792 | 0.0479 | 0.2317 | 6.5 | |
4 | 7oq4:E | 72 | 40 | 0.0708 | 0.2361 | 0.4250 | 8.2 |