MDHAIYTAMGAASQTLNQQAVTASNLANASTPGFRAQLNALRAVPVDGLSLATRTLVTASTPGADMTPGQLDYTSRPLDV
The query sequence (length=250) is searched through a non-redundant set of database sequences
clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# |
Hit |
Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value |
Homologs to hit |
1 |
8wk3:o |
250 |
250 |
1.0000 |
1.0000 |
1.0000 |
0.0 |
7cgo:b, 7cgo:e, 7cgo:a, 7cgo:c, 7cgo:d, 7e80:b, 7e80:e, 7e80:a, 7e80:c, 7e80:d, 7e82:b, 7e82:e, 7e82:a, 7e82:c, 7e82:d, 8wk3:m, 8wk3:n, 8wk3:p, 8wk3:q, 8wkk:m, 8wkk:n, 8wkk:o, 8wkk:p, 8wkk:q, 8wl2:AA, 8wl2:AB, 8wl2:AC, 8wl2:AD, 8wl2:AE, 8wlh:m, 8wlh:n, 8wlh:o, 8wlh:q, 8wlq:m, 8wlq:n, 8wlq:o, 8wlq:q, 8wlt:AA, 8wlt:AB, 8wlt:AC, 8wlt:AE, 8wo5:AA, 8wo5:AB, 8wo5:AC, 8wo5:AE, 8woe:AA, 8woe:AB, 8woe:AC, 8woe:AD, 8woe:AE |
2 |
8wkk:u |
254 |
253 |
0.3200 |
0.3150 |
0.3162 |
6.40e-15 |
8wl2:AI, 8woe:AI |
3 |
8wk3:Q |
119 |
37 |
0.0520 |
0.1092 |
0.3514 |
1.6 |
7cg0:k, 7cg0:n, 7cg0:o, 7cgo:k, 7cgo:n, 7cgo:o, 7e80:k, 7e80:n, 7e80:o, 7e82:k, 7e82:n, 7e82:o, 8wk3:R, 8wk3:S, 8wk3:T, 8wkk:Q, 8wkk:R, 8wkk:S, 8wkk:T, 8wlh:Q, 8wlh:R, 8wlh:S, 8wlh:T, 8wlq:Q, 8wlq:R, 8wlq:S, 8wlq:T |
4 |
7cg0:m |
106 |
37 |
0.0520 |
0.1226 |
0.3514 |
1.8 |
7cg0:l, 7cgo:m, 7cgo:l, 7e80:m, 7e80:l, 7e82:m, 7e82:l, 8wk3:U, 8wkk:U, 8wlh:U, 8wlq:U |
5 |
7og0:B |
498 |
59 |
0.0800 |
0.0402 |
0.3390 |
2.1 |
7ofw:A, 7ofz:A, 7og0:A |
6 |
8wkq:Q |
134 |
37 |
0.0520 |
0.0970 |
0.3514 |
3.0 |
8wkq:R, 8wkq:S, 8wkq:T, 8wkq:U, 8wl2:A6, 8wl2:A7, 8wl2:A8, 8wl2:A9, 8wl2:A0, 8wln:Q, 8wln:R, 8wln:S, 8wln:T, 8wln:U, 8wlt:A6, 8wlt:A7, 8wlt:A8, 8wlt:A9, 8wlt:A0, 8wo5:A6, 8wo5:A7, 8wo5:A8, 8wo5:A9, 8wo5:A0, 8woe:A6, 8woe:A7, 8woe:A8, 8woe:A9, 8woe:A0 |
7 |
8fmw:F |
97 |
37 |
0.0400 |
0.1031 |
0.2703 |
8.5 |
|