BioLiP

>protein
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLK
IYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQ
RRLFIQKEEQL

The query sequence (length=171) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7enc:0	306	171	1.0000	0.5588	1.0000	7.17e-123	1g25:A, 8gxq:HD, 8gxs:HD, 6nmi:H, 7nvw:3, 7nvx:3, 7nvy:3, 7nvz:3, 8wak:0, 8wal:0, 8wan:0, 8wao:0, 8wap:0, 8waq:0, 8war:0, 8was:0
2	7lbm:d	275	171	1.0000	0.6218	1.0000	7.63e-123	8byq:7
3	7egb:0	236	171	1.0000	0.7246	1.0000	1.40e-122	7egc:0
4	7nvr:3	214	151	0.8830	0.7056	1.0000	1.39e-108
5	6gym:3	138	133	0.3509	0.4348	0.4511	2.84e-34	8cen:3, 8ceo:3, 7ml0:3, 7ml1:3, 7ml2:3, 7ml3:3, 7o4i:3, 7o4j:3, 7o4k:3, 7o4l:3, 7o72:3, 7o73:3, 7o75:3, 5oqj:3, 5oqm:3, 7zs9:3, 7zsa:3, 7zsb:3
6	6yxe:A	89	75	0.1520	0.2921	0.3467	0.036	6yxe:B
7	2ecw:A	85	42	0.0819	0.1647	0.3333	0.086
8	7bbd:B	160	44	0.0760	0.0813	0.2955	0.48	8a58:C, 8a58:D, 8c07:I, 8f1f:C, 8f1f:c, 6fga:A, 6fga:B, 6fga:C, 6fga:D, 6fga:E, 6fga:F, 6fga:G, 6fga:H, 5m93:B, 5m93:C, 7nbb:C, 5o44:E, 6s53:B, 6s53:A, 6s53:H, 6s53:G, 3zlz:B
9	7xyz:B	456	45	0.0819	0.0307	0.3111	1.1	7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D
10	6c9a:B	723	54	0.1053	0.0249	0.3333	1.7	6c9a:A
11	3fl2:A	116	35	0.0702	0.1034	0.3429	2.0
12	4v3p:Ll	94	45	0.0877	0.1596	0.3333	2.2	8ip8:UA, 8ipa:UA, 8ipb:UA, 8jiv:Cj, 4v7e:Cj
13	2egp:A	79	31	0.0643	0.1392	0.3548	2.3
14	6l8n:A	810	57	0.1053	0.0222	0.3158	2.6
15	7x1i:A	678	45	0.0936	0.0236	0.3556	2.7	7x1i:B, 7x1j:B, 7x1j:A
16	5olm:B	132	24	0.0526	0.0682	0.3750	3.0	5jpx:A, 5olm:A
17	2ecv:A	85	39	0.0643	0.1294	0.2821	3.0
18	8p5d:LJJ	89	83	0.1111	0.2135	0.2289	3.3	8p60:LJJ, 8p60:KJJ, 7qca:LJJ
19	8bal:F	348	34	0.0585	0.0287	0.2941	4.0	8bal:A, 8bal:C, 8bal:D, 8bal:E
20	2ecy:A	66	24	0.0585	0.1515	0.4167	4.3
21	2ysl:A	73	36	0.0760	0.1781	0.3611	4.9	2ysj:A
22	7oik:A	4426	28	0.0585	0.0023	0.3571	5.1	7oim:A, 6tax:A, 6tay:A
23	3pih:A	836	23	0.0643	0.0132	0.4783	5.4
24	4v6w:Cj	92	45	0.0819	0.1522	0.3111	5.4	6xu8:Cj
25	4s3o:C	95	28	0.0643	0.1158	0.3929	5.4	4s3o:F
26	6psm:C	448	51	0.0877	0.0335	0.2941	6.9	6prm:A, 6prm:B, 6prm:C, 6prm:D, 6psm:A, 6psm:B, 6psm:D, 6psm:E, 6psm:F, 6pso:B, 6pso:A
27	6stu:A	204	37	0.0760	0.0637	0.3514	7.9	8ofs:A, 8ofs:B, 8ofs:C
28	2ct2:A	88	48	0.0936	0.1818	0.3333	8.2	5fey:A, 5fey:B
29	8cwp:A	327	42	0.0819	0.0428	0.3333	8.6
30	6zu5:LO0	196	76	0.1462	0.1276	0.3289	9.5
31	7qe7:K	531	44	0.0702	0.0226	0.2727	9.6	5a31:J, 5a31:K, 5g04:J, 5g04:K, 5g05:J, 5g05:K, 9gaw:Q, 9gaw:K, 3hym:B, 3hym:D, 3hym:F, 3hym:H, 3hym:J, 3hym:L, 5lcw:J, 5lcw:K, 8pkp:Q, 8pkp:K, 6q6g:Q, 6q6g:K, 6q6h:Q, 6q6h:K, 7qe7:Q, 8s4g:Q, 8s4g:K, 6tlj:J, 6tlj:K, 6tm5:J, 6tm5:K, 6tnt:J, 6tnt:K, 4ui9:J, 4ui9:K
32	2pv3:A	284	49	0.0877	0.0528	0.3061	10.0	2pv1:A, 2pv2:A, 2pv2:B, 2pv2:C, 2pv2:D, 2pv3:B

[Back]