MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDKEVEIRKKVLK
IYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKKKMEIYQKENKDVIQKNKLKLTREQEELEE
The query sequence (length=149) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7lbm:d | 275 | 149 | 1.0000 | 0.5418 | 1.0000 | 4.04e-107 | 8byq:7 |
2 | 7enc:0 | 306 | 149 | 1.0000 | 0.4869 | 1.0000 | 4.75e-107 | 1g25:A, 8gxq:HD, 8gxs:HD, 6nmi:H, 7nvw:3, 7nvx:3, 7nvy:3, 7nvz:3, 8wak:0, 8wal:0, 8wan:0, 8wao:0, 8wap:0, 8waq:0, 8war:0, 8was:0 |
3 | 7nvr:3 | 214 | 149 | 1.0000 | 0.6963 | 1.0000 | 6.82e-107 | |
4 | 7egb:0 | 236 | 149 | 1.0000 | 0.6314 | 1.0000 | 7.61e-107 | 7egc:0 |
5 | 6gym:3 | 138 | 132 | 0.4027 | 0.4348 | 0.4545 | 2.17e-34 | 8cen:3, 8ceo:3, 7ml0:3, 7ml1:3, 7ml2:3, 7ml3:3, 7o4i:3, 7o4j:3, 7o4k:3, 7o4l:3, 7o72:3, 7o73:3, 7o75:3, 5oqj:3, 5oqm:3, 7zs9:3, 7zsa:3, 7zsb:3 |
6 | 6yxe:A | 89 | 75 | 0.1745 | 0.2921 | 0.3467 | 0.021 | 6yxe:B |
7 | 2ecw:A | 85 | 42 | 0.0940 | 0.1647 | 0.3333 | 0.10 | |
8 | 7bbd:B | 160 | 34 | 0.0738 | 0.0688 | 0.3235 | 0.56 | 8a58:C, 8a58:D, 8c07:I, 8f1f:C, 8f1f:c, 6fga:A, 6fga:B, 6fga:C, 6fga:D, 6fga:E, 6fga:F, 6fga:G, 6fga:H, 5m93:B, 5m93:C, 7nbb:C, 5o44:E, 6s53:B, 6s53:A, 6s53:H, 6s53:G, 3zlz:B |
9 | 7xyz:B | 456 | 45 | 0.0940 | 0.0307 | 0.3111 | 1.3 | 7xv2:A, 7xyy:A, 7xyy:B, 7xyz:A, 7xyz:C, 7xyz:D, 7xz0:A, 7xz0:B, 7xz1:A, 7xz1:B, 7xz2:A, 7xz2:B, 7xz2:C, 7xz2:D |
10 | 6l8n:A | 810 | 57 | 0.1208 | 0.0222 | 0.3158 | 1.4 | |
11 | 3fl2:A | 116 | 35 | 0.0805 | 0.1034 | 0.3429 | 1.4 | |
12 | 4v3p:Ll | 94 | 45 | 0.1007 | 0.1596 | 0.3333 | 1.8 | 8ip8:UA, 8ipa:UA, 8ipb:UA, 8jiv:Cj, 4v7e:Cj |
13 | 2ecv:A | 85 | 39 | 0.0738 | 0.1294 | 0.2821 | 2.0 | |
14 | 8p5d:LJJ | 89 | 83 | 0.1275 | 0.2135 | 0.2289 | 2.2 | 8p60:LJJ, 8p60:KJJ, 7qca:LJJ |
15 | 5olm:B | 132 | 24 | 0.0604 | 0.0682 | 0.3750 | 2.6 | 5jpx:A, 5olm:A |
16 | 2egp:A | 79 | 31 | 0.0738 | 0.1392 | 0.3548 | 2.7 | |
17 | 8bal:F | 348 | 34 | 0.0671 | 0.0287 | 0.2941 | 3.1 | 8bal:A, 8bal:C, 8bal:D, 8bal:E |
18 | 2ecy:A | 66 | 24 | 0.0671 | 0.1515 | 0.4167 | 3.1 | |
19 | 2ysl:A | 73 | 36 | 0.0872 | 0.1781 | 0.3611 | 3.5 | 2ysj:A |
20 | 3pih:A | 836 | 23 | 0.0738 | 0.0132 | 0.4783 | 4.2 | |
21 | 4v6w:Cj | 92 | 45 | 0.0940 | 0.1522 | 0.3111 | 4.5 | 6xu8:Cj |
22 | 4s3o:C | 95 | 28 | 0.0738 | 0.1158 | 0.3929 | 4.6 | 4s3o:F |
23 | 6stu:A | 204 | 37 | 0.0872 | 0.0637 | 0.3514 | 5.0 | 8ofs:A, 8ofs:B, 8ofs:C |
24 | 7oik:A | 4426 | 28 | 0.0671 | 0.0023 | 0.3571 | 5.3 | 7oim:A, 6tax:A, 6tay:A |
25 | 2ct2:A | 88 | 48 | 0.1074 | 0.1818 | 0.3333 | 5.5 | 5fey:A, 5fey:B |
26 | 6zu5:LO0 | 196 | 76 | 0.1678 | 0.1276 | 0.3289 | 6.2 | |
27 | 8cwp:A | 327 | 42 | 0.0940 | 0.0428 | 0.3333 | 6.7 | |
28 | 7lvy:A | 431 | 26 | 0.0671 | 0.0232 | 0.3846 | 7.7 | 7mco:A, 7mco:B |
29 | 2pv3:A | 284 | 49 | 0.1007 | 0.0528 | 0.3061 | 8.6 | 2pv1:A, 2pv2:A, 2pv2:B, 2pv2:C, 2pv2:D, 2pv3:B |
30 | 3zni:A | 390 | 27 | 0.0604 | 0.0231 | 0.3333 | 8.9 | 4a49:A, 5axi:B, 5axi:A, 5axi:C, 9fqh:A, 9fqi:A, 9fqj:A, 9fqj:B, 8gcy:A, 2ldr:A, 3pfv:A, 3pfv:B, 8qng:A, 8qnh:A, 8qni:A, 8qtg:A, 8qth:A, 8qtj:A, 8qtk:A, 8vw4:A, 8vw4:B, 8vw5:A, 8vw5:B, 3zni:E, 3zni:I, 3zni:M |
31 | 6sc6:A | 365 | 53 | 0.0940 | 0.0384 | 0.2642 | 9.6 | 5edv:A, 5edv:B, 6gzy:A, 6gzy:B, 6kc5:B, 6kc6:A, 6kc6:C, 6kc6:E, 6kc6:G, 6kc6:I, 6kc6:K, 4ljo:A, 4ljp:A, 4ljq:B, 4ljq:C, 4ljq:A, 4ljq:D, 6sc5:A, 6sc7:A, 6sc8:A, 6sc9:A, 7v8f:B, 7v8g:D, 7v8g:C |
32 | 4xxk:A | 149 | 83 | 0.1275 | 0.1275 | 0.2289 | 9.8 | 4xxi:A, 4xxi:B, 4xxk:B |