MAWNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVTWNQCNGPEFADGSWAYYREYIAWVVFPKKVMTKNGYPL
FIEVHNKGSWSEENTGDNDSYFFLKGYKWDQRAFDTANLCQKPGETTRLTEKFDDIIFKVALPADLPLGDYSVTIPYTSG
IQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGG
The query sequence (length=198) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 4z3g:A | 198 | 198 | 1.0000 | 1.0000 | 1.0000 | 4.37e-150 | 1j8r:A, 4z3e:A, 4z3f:A, 4z3g:B, 4z3h:A |
2 | 1su3:B | 416 | 73 | 0.1111 | 0.0529 | 0.3014 | 0.43 | 966c:A, 4auo:A, 4auo:B, 1ayk:A, 2ayk:A, 3ayk:A, 4ayk:A, 1cge:A, 1cgf:A, 1cgf:B, 1cgl:A, 1cgl:B, 2clt:A, 2clt:B, 1hfc:A, 2j0t:A, 2j0t:B, 2j0t:C, 3shi:A, 3shi:G, 3shi:M, 1su3:A, 2tcl:A |
3 | 5dg2:B | 131 | 69 | 0.1162 | 0.1756 | 0.3333 | 0.86 | 5dg1:C, 5dg1:H, 5dg1:D, 5dg1:I, 5ews:C, 5ews:D, 5ews:A, 5ews:G, 5ews:H, 5ews:I, 5ews:J, 5ews:K, 5ews:M, 5ews:N, 1hlc:A, 1hlc:B |
4 | 6nbk:A | 289 | 48 | 0.0808 | 0.0554 | 0.3333 | 3.3 | 6nbk:B, 6nbk:C, 6nbk:D, 6nbk:E, 6nbk:F |
5 | 2rem:C | 191 | 60 | 0.0909 | 0.0942 | 0.3000 | 4.1 | |
6 | 4pl6:A | 57 | 16 | 0.0404 | 0.1404 | 0.5000 | 6.8 | 4pl6:B, 4pli:A, 4pli:B, 4pll:A, 4pll:B |
7 | 1uf2:A | 967 | 25 | 0.0505 | 0.0103 | 0.4000 | 8.1 | |
8 | 3s3s:A | 620 | 115 | 0.1162 | 0.0371 | 0.2000 | 8.7 | 3s3p:A |
9 | 8wch:A | 396 | 74 | 0.1010 | 0.0505 | 0.2703 | 9.8 | 8wch:B |