MAWLILIIAGIFEVVWAIALKYSNGFTRLIPSMITLIGMLISFYLLSQATKTLPIGTAYAIWTGIGALGAVICGIIFFKE
PLTALRIVFMILLLTGIIGLKATS
The query sequence (length=104) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7szt:A | 104 | 104 | 1.0000 | 1.0000 | 1.0000 | 1.97e-67 | 8tgy:A, 8tgy:E, 8vxu:A, 8vxu:B, 8vxu:C, 8vxu:D, 6wk8:B, 6wk8:A, 6wk9:B, 6wk9:A, 6wk9:F, 6wk9:E |
2 | 8uoz:A | 110 | 86 | 0.3269 | 0.3091 | 0.3953 | 1.54e-12 | 7jk8:A, 7jk8:B, 7mgx:A, 7mgx:B, 7mgx:E, 7mgx:F, 7sfq:A, 7sfq:B, 7ssu:A, 7ssu:B, 7sv9:B, 7sv9:A, 7svx:B, 8uoz:B |
3 | 5u34:A | 960 | 22 | 0.1154 | 0.0125 | 0.5455 | 4.4 | |
4 | 5wqe:A | 1011 | 22 | 0.1154 | 0.0119 | 0.5455 | 4.4 | |
5 | 5u30:A | 1085 | 22 | 0.1154 | 0.0111 | 0.5455 | 4.5 | 5u31:A, 5u33:A |
6 | 8zpt:R | 292 | 43 | 0.1250 | 0.0445 | 0.3023 | 8.2 | 8zps:R |