MATLLRSLALFKRNKDKPPITSGSGGAIRGIKHIIIVPIPGDSSITTRSRLLDRLVRLIGNPDVSGPKLTGALIGILSLF
VESPGQLIQRITDDPDVSIRLLEVVQSDQSQSGLTFAEDEADQYFSHSRFGWFENKEISDIEVQDPEGFNMILGTILAQI
WVLVAKAVTAPDTAADSELRRWIKYTQQRRVVGEFRLERKWLDVVRNRIAEDLSLRRFMVALILDIKRTPGNKPRIAEMI
CNIDTYIVEAGLASFILTIKFGIETMYPALGLHEFDGELSTLESLMNLYQQMGETAPYMVILENSIQNKFSAGSYPLLWS
YAMGVGVELENSMGGLNFGRSYFDPAYFRLGQEMVRRSAGKVSSTLASELGITAEDA
The query sequence (length=377) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6h5q:B | 381 | 377 | 0.9867 | 0.9764 | 0.9867 | 0.0 | 6h5s:C, 4uft:B |
2 | 7oi3:E | 394 | 390 | 0.8753 | 0.8376 | 0.8462 | 0.0 | |
3 | 7nt5:B | 395 | 355 | 0.3714 | 0.3544 | 0.3944 | 7.81e-86 | 8c4h:C, 8c4h:D, 8c4h:E, 8c4h:F, 8c4h:G, 8c4h:H, 8c4h:I, 8c4h:J, 8c4h:K, 8c4h:L, 8c4h:M, 8c4h:N, 8c4h:A, 8c4h:B, 8c4h:a, 8c4h:b, 8c4h:c, 8c4h:d, 8c4h:e, 8c4h:f, 8c4h:g, 8c4h:h, 8c4h:i, 8c4h:j, 8c4h:k, 8c4h:l, 8c4h:m, 8c4h:n, 8cbw:A, 7nt5:A, 7nt5:C, 7nt5:D, 7nt5:E, 7nt5:F, 7nt5:G, 7nt5:H, 7nt5:I, 7nt5:J, 7nt5:K, 7nt5:L, 7nt5:M, 7nt6:H, 7nt6:J, 7nt6:K, 7nt6:L, 7nt6:M, 7nt6:N, 7nt6:O, 7nt6:C, 7nt6:D, 7nt6:E, 7nt6:F, 7nt6:G |
4 | 7ozr:A | 403 | 359 | 0.2865 | 0.2680 | 0.3008 | 3.75e-44 | 7ewq:A, 7exa:A |
5 | 4xjn:A | 395 | 373 | 0.3050 | 0.2911 | 0.3083 | 4.04e-43 | 5wkn:A, 5wkn:B, 4xjn:B, 4xjn:C, 4xjn:D, 4xjn:E, 4xjn:F, 4xjn:G, 4xjn:H, 4xjn:I, 4xjn:J, 4xjn:K, 4xjn:L, 4xjn:M |
6 | 6jc3:A | 391 | 236 | 0.2202 | 0.2123 | 0.3517 | 9.51e-42 | |
7 | 6m7d:A | 412 | 385 | 0.2732 | 0.2500 | 0.2675 | 3.90e-36 | |
8 | 7ev8:A | 328 | 223 | 0.1936 | 0.2226 | 0.3274 | 3.07e-31 | |
9 | 7f1m:A | 394 | 78 | 0.0557 | 0.0533 | 0.2692 | 2.22e-04 | 7f1m:B, 5f5o:A, 5f5o:C, 5f5o:E, 5xsq:A, 5xsq:C, 5xsq:E |
10 | 5z9w:A | 388 | 77 | 0.0504 | 0.0490 | 0.2468 | 0.009 | 6nut:A, 4ypi:C, 4ypi:A, 4ypi:B, 4ypi:D |
11 | 7ypw:A | 388 | 96 | 0.0663 | 0.0644 | 0.2604 | 0.010 | 7yr8:A |
12 | 4zlh:B | 338 | 38 | 0.0345 | 0.0385 | 0.3421 | 3.2 | 8v24:A, 8v24:C, 7wzb:B, 7wzb:A, 4zlh:A |
13 | 4v4n:AZ | 99 | 35 | 0.0345 | 0.1313 | 0.3714 | 8.5 | 4v6u:BZ |
14 | 6kc0:A | 674 | 74 | 0.0557 | 0.0312 | 0.2838 | 8.8 | 6kbd:A |