MATESPNSVQKIVVHLRATGGAPILKQSKFKVSGSDKFANVIDFLRRQLHSDSLFVYVNSAFSPNPDESVIDLYNNFGFD
GKLVVNYACSMAWG
The query sequence (length=94) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
| # | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
|---|---|---|---|---|---|---|---|---|
| 1 | 7eu4:C | 94 | 94 | 1.0000 | 1.0000 | 1.0000 | 5.75e-67 | 7eu4:A, 7eu4:E, 7eu4:G |
| 2 | 4naw:A | 88 | 88 | 0.4149 | 0.4432 | 0.4432 | 4.04e-22 | 4naw:E, 4naw:I, 4naw:M |
| 3 | 5cx3:A | 119 | 95 | 0.2234 | 0.1765 | 0.2211 | 0.030 | 5cx3:B, 5cx3:C, 5cx3:D, 7r9w:A, 7r9z:A, 7ra0:A, 6tbe:A |
| 4 | 5e6o:A | 117 | 98 | 0.2660 | 0.2137 | 0.2551 | 0.31 | 5e6o:B, 5e6o:C, 5e6o:D |
| 5 | 7bvq:A | 455 | 33 | 0.1596 | 0.0330 | 0.4545 | 0.43 | 7bts:A, 7bu6:A, 7bu7:A, 7bvq:B |
| 6 | 8pxc:A | 252 | 42 | 0.1915 | 0.0714 | 0.4286 | 1.2 | |
| 7 | 7elg:A | 122 | 62 | 0.1489 | 0.1148 | 0.2258 | 1.3 | 5d94:A, 7ga8:A, 7ga9:A, 7gaa:A, 7gab:A, 7gac:A, 7gad:A, 7gae:A, 7gaf:A, 7gag:A, 7gah:A, 7gai:A, 7gaj:A, 7gak:A, 7gal:A, 7gam:A, 7gan:A, 7gao:A, 7gaq:A, 7gar:A, 7gas:A, 5gmv:B, 5gmv:A, 2k6q:A, 2lue:A, 2n9x:A, 8q7k:A, 8q7k:B, 5wrd:A, 5wrd:B, 5xad:A, 5xad:B, 5yiq:A, 5yis:B, 5yis:A, 2zjd:A, 2zjd:C |
| 8 | 1tah:B | 318 | 30 | 0.1383 | 0.0409 | 0.4333 | 2.1 | 1cvl:A, 2es4:A, 2es4:B, 1qge:E, 1tah:A, 1tah:C, 1tah:D |
| 9 | 8khq:A | 700 | 71 | 0.1702 | 0.0229 | 0.2254 | 3.0 | 8khq:B, 8khq:C, 8khq:D |
| 10 | 7oi6:x | 374 | 49 | 0.1489 | 0.0374 | 0.2857 | 3.6 | |
| 11 | 7k6w:A | 278 | 39 | 0.1383 | 0.0468 | 0.3333 | 7.9 | 7k6w:B, 7k6w:C, 7k6w:D |
| 12 | 5k8g:A | 511 | 79 | 0.2128 | 0.0391 | 0.2532 | 9.4 | 6x5v:A, 6x5w:A, 6x6m:A, 6x6q:A |
umich.edu