MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPPYKVEESGYAG
FILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKA
The query sequence (length=138) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 2ndf:A | 141 | 138 | 1.0000 | 0.9787 | 1.0000 | 3.28e-101 | 7eic:A, 7eic:B, 7eid:A, 7eid:B, 5hjb:A, 5hjd:G, 5hjd:K, 5hjd:A, 5hjd:C, 5hjd:E, 5hjd:T, 5hjd:Q, 5hjd:N, 6l5z:A, 6ls6:A, 6ls6:B, 6mil:A, 6mil:C, 6mim:A, 6mim:C, 2ndg:A, 8pj7:A, 4tmp:A, 4tmp:C, 7vkg:A, 7vkh:A, 7vkh:B, 5yyf:A, 5yyf:C |
2 | 5j9s:A | 150 | 134 | 0.8116 | 0.7467 | 0.8358 | 1.99e-82 | 7b0t:A, 7b10:A, 7e74:A, 7e74:D, 7e74:C, 7e74:B, 7e7c:A, 6hpw:A, 6hpx:A, 6hpy:A, 6hpz:A, 6ht0:A, 6ht1:A, 8pji:A, 6t1i:A, 6t1j:A, 6t1l:A, 6t1m:A, 6t1n:A, 6t1o:A, 7x88:A, 7x8b:A, 7x8b:C, 7x8f:A, 7x8f:C, 7x8g:A, 7x8g:C |
3 | 6axj:A | 143 | 109 | 0.2826 | 0.2727 | 0.3578 | 4.84e-21 | 6axj:B, 6axj:D, 6axj:C, 5wyi:B, 5wyi:C |
4 | 8jg4:B | 154 | 136 | 0.3043 | 0.2727 | 0.3088 | 2.42e-15 | 8jg4:A |
5 | 5iok:A | 142 | 57 | 0.1667 | 0.1620 | 0.4035 | 1.41e-10 | 5d7e:A, 7f4a:A, 6min:A, 6mio:A, 6miq:A |
6 | 8iiy:A | 506 | 59 | 0.1667 | 0.0455 | 0.3898 | 1.52e-10 | 8dkb:A, 8dkb:B, 8dkb:C, 8dkb:D, 8dkb:E, 8dkb:F, 8dkb:G, 8dkb:H, 8i60:C, 8i60:D, 8iiz:A, 8ij0:A, 8ij0:B, 7jfy:B, 7jfy:A, 7jfy:C, 7jfy:D, 5r68:B, 5r68:A, 5r69:B, 5r69:A, 5vnb:A, 5vnb:B, 5vnb:D, 5xtz:A, 5y8v:D |
7 | 8x1c:W | 187 | 59 | 0.1667 | 0.1230 | 0.3898 | 3.11e-10 | |
8 | 6lsd:B | 135 | 70 | 0.1957 | 0.2000 | 0.3857 | 2.53e-09 | 5iql:A, 6lsd:A, 5xnv:A |
9 | 7f5m:A | 139 | 42 | 0.1232 | 0.1223 | 0.4048 | 1.97e-05 | 7f5m:B |
10 | 6dht:A | 547 | 49 | 0.1159 | 0.0293 | 0.3265 | 1.7 | |
11 | 5nld:B | 138 | 51 | 0.1014 | 0.1014 | 0.2745 | 5.1 | 5nle:A, 5nle:B, 5nle:C, 5nle:D, 5nlh:A, 5nm1:A, 5nm1:B, 5nm1:C, 5nm1:D, 5nmj:A, 7p8h:C, 7p8h:A |
12 | 2kg1:A | 105 | 40 | 0.0942 | 0.1238 | 0.3250 | 5.3 | |
13 | 7sva:A | 792 | 21 | 0.0870 | 0.0152 | 0.5714 | 6.1 | 7swf:A, 7swq:A |
14 | 3zdr:A | 403 | 85 | 0.1667 | 0.0571 | 0.2706 | 8.3 | |
15 | 4e8c:A | 594 | 35 | 0.0797 | 0.0185 | 0.3143 | 9.0 | 4e8c:B |