MASGKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFK
FSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQ
The query sequence (length=142) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 3hqi:A | 294 | 139 | 0.9296 | 0.4490 | 0.9496 | 1.53e-88 | 7d3d:A, 7d3d:B, 6f8f:D, 6f8g:A, 6f8g:C, 6f8g:D, 6f8g:B, 3hqh:A, 3hqi:B, 3hql:A, 3hql:B, 3hqm:A, 3hqm:B, 3hsv:A, 3hsv:B, 3hu6:A, 3hu6:B, 6i41:A, 6i5p:A, 6i5p:C, 6i5p:E, 6i5p:G, 6i68:A, 6i68:C, 6i68:E, 6i68:G, 6i7a:A, 6i7a:C, 6i7a:E, 6i7a:G, 3ivb:A, 3ivq:A, 3ivq:B, 3ivv:A, 7klz:A, 7klz:B, 7kpk:A, 7lin:A, 7lio:A, 7lio:B, 4o1v:A |
2 | 2f1w:A | 144 | 52 | 0.1056 | 0.1042 | 0.2885 | 0.22 | 2foj:A, 2foo:A, 2fop:A, 4jjq:A, 4kg9:A, 3mqr:A, 3mqs:C, 2xxn:A, 4ysi:A, 1yy6:A |
3 | 6jpk:A | 409 | 66 | 0.1549 | 0.0538 | 0.3333 | 1.4 | 6jpk:B |
4 | 8ip8:HB | 205 | 74 | 0.1549 | 0.1073 | 0.2973 | 1.8 | 8ipa:HB, 8ipb:HB, 8jiv:CI |
5 | 8azw:g | 209 | 58 | 0.1197 | 0.0813 | 0.2931 | 3.3 | 8b2l:g3, 7qiw:L, 7qiz:L |
6 | 4wji:A | 293 | 22 | 0.0634 | 0.0307 | 0.4091 | 5.4 | |
7 | 2hrb:A | 273 | 34 | 0.0775 | 0.0403 | 0.3235 | 5.7 | |
8 | 8eug:I | 170 | 54 | 0.1056 | 0.0882 | 0.2778 | 8.5 | 8eui:I |