MASDVANNKSSLEDGCLSCGSFHPLFEGGLCQCTVCCEGRELLLCCVECLEVLVGTSCYMCLPQRCHGVLRRRKDWNVRL
QAFF
The query sequence (length=84) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7o45:D | 84 | 84 | 1.0000 | 1.0000 | 1.0000 | 1.84e-57 | |
2 | 8eik:C | 407 | 131 | 1.0000 | 0.2064 | 0.6412 | 2.47e-42 | |
3 | 8eii:B | 439 | 131 | 1.0000 | 0.1913 | 0.6412 | 2.76e-42 | 8eih:A, 8eih:B, 8eih:C, 8eii:A, 8eii:C, 8eij:A, 8eij:B, 8eik:A, 8eik:B, 6kda:A, 6kda:D, 6kdb:A, 6kdb:D, 6kdl:A, 6kdl:D, 6kdp:A, 6kdp:D, 6kdt:A, 6kdt:D, 7o45:A, 7o45:B, 7o45:C, 6u8p:A, 6u8p:D, 6u8v:A, 6u8v:D, 6u8w:A, 6u8w:D, 6u8x:A, 6u8x:D, 6u90:A, 6u90:D, 6u91:A, 6u91:D, 7v0e:A, 7v0e:B, 7v0e:C, 7v0e:D, 7v0e:E, 7v0e:F, 7v0e:G, 7v0e:H, 7x9d:A, 7x9d:D |
4 | 8eik:E | 378 | 107 | 0.7619 | 0.1693 | 0.5981 | 6.07e-28 | |
5 | 8eih:D | 256 | 100 | 0.6190 | 0.2031 | 0.5200 | 2.73e-18 | |
6 | 4u7p:A | 426 | 121 | 0.5595 | 0.1103 | 0.3884 | 1.00e-16 | 3a1a:A, 3a1b:A, 8ba5:A, 6brr:A, 6brr:D, 6f57:A, 6f57:D, 6pa7:K, 6pa7:P, 4qbq:C, 4qbq:A, 4qbr:A, 4qbr:C, 4qbs:A, 2qrv:A, 2qrv:D, 2qrv:E, 2qrv:H, 8tdr:A, 8tdr:B, 8tdr:C, 8tdr:D, 8te1:A, 8te1:B, 8te1:C, 8te1:D, 8te3:A, 8te3:B, 8te3:C, 8te3:D, 8te4:A, 8te4:B, 8te4:C, 8te4:D, 4u7t:A, 4u7t:C, 6w89:A, 6w89:D, 6w89:G, 6w89:J, 6w8b:A, 6w8b:D, 6w8b:H, 6w8b:K, 6w8d:A, 6w8d:D, 6w8j:A, 6w8j:D, 5yx2:A, 5yx2:D |
7 | 2pv0:B | 347 | 131 | 0.5119 | 0.1239 | 0.3282 | 1.23e-14 | 2pv0:A, 2pv0:C, 2pvc:B, 2pvc:A, 2pvc:C |
8 | 6laa:A | 753 | 34 | 0.1548 | 0.0173 | 0.3824 | 4.8 | 6gii:A, 6ldl:A |
9 | 2plj:A | 376 | 37 | 0.1190 | 0.0266 | 0.2703 | 6.5 | 2plj:B, 2plk:A, 2plk:B |
10 | 3h9a:A | 225 | 36 | 0.1310 | 0.0489 | 0.3056 | 6.9 | 3h7j:A, 3h7j:B, 3h7y:A, 3h7y:B, 3h9a:B |
11 | 1w78:A | 414 | 22 | 0.1310 | 0.0266 | 0.5000 | 9.1 | 1w7k:A |