MARGVNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETYTDSDGNEVQNTEWHDVVAWGRLGEICNEYLDKGSQVYFEG
KLQTRSWTRYSTEVKAQEMMFL
The query sequence (length=102) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5odp:G | 100 | 101 | 0.9118 | 0.9300 | 0.9208 | 1.09e-63 | 5odp:A |
2 | 5odn:D | 106 | 108 | 0.9118 | 0.8774 | 0.8611 | 2.50e-61 | 5odn:F, 5odn:G, 5odn:B, 5odn:C, 5odn:A, 5odn:E, 5odn:H |
3 | 1eqq:B | 120 | 100 | 0.5588 | 0.4750 | 0.5700 | 9.27e-35 | 1eqq:A, 1eyg:A, 1eyg:B, 1eyg:C, 1eyg:D |
4 | 6irq:C | 104 | 96 | 0.5392 | 0.5288 | 0.5729 | 3.74e-32 | 6irq:A, 6irq:B, 6irq:D, 6jdg:C, 6jdg:A, 6jdg:B, 6jdg:D, 7vum:A, 7vum:C, 5yun:B, 5yun:A, 5yun:D |
5 | 6bhx:C | 102 | 104 | 0.3824 | 0.3824 | 0.3750 | 1.81e-18 | 6bhx:A, 6bhx:B |
6 | 3ulp:C | 116 | 95 | 0.3333 | 0.2931 | 0.3579 | 8.09e-18 | 3ulp:A, 3ulp:B, 3ulp:D |
7 | 7dep:B | 102 | 100 | 0.3725 | 0.3725 | 0.3800 | 1.72e-17 | |
8 | 2vw9:A | 108 | 82 | 0.3333 | 0.3148 | 0.4146 | 5.81e-17 | 2vw9:B |
9 | 3vdy:A | 101 | 99 | 0.3627 | 0.3663 | 0.3737 | 3.84e-16 | 3vdy:B |
10 | 6rup:A | 111 | 109 | 0.3529 | 0.3243 | 0.3303 | 9.17e-15 | 6rup:B, 8uzt:A, 8uzt:C, 8uzt:D |
11 | 8uzt:B | 100 | 103 | 0.3431 | 0.3500 | 0.3398 | 1.94e-13 | |
12 | 8gw5:A | 99 | 104 | 0.3333 | 0.3434 | 0.3269 | 5.18e-13 | 7ym1:A |
13 | 3udg:C | 214 | 96 | 0.3529 | 0.1682 | 0.3750 | 7.18e-13 | 3udg:B, 3udg:A |
14 | 3udg:C | 214 | 105 | 0.3922 | 0.1869 | 0.3810 | 6.95e-10 | 3udg:B, 3udg:A |
15 | 3a5u:A | 118 | 93 | 0.3431 | 0.2966 | 0.3763 | 9.11e-13 | 3a5u:B |
16 | 5gqo:A | 97 | 51 | 0.1667 | 0.1753 | 0.3333 | 0.15 | |
17 | 1zm8:A | 239 | 64 | 0.1667 | 0.0711 | 0.2656 | 0.66 | |
18 | 7f75:D | 1142 | 33 | 0.1176 | 0.0105 | 0.3636 | 3.0 | 7ckq:D |
19 | 6zca:Y | 1127 | 33 | 0.1176 | 0.0106 | 0.3636 | 3.1 | 6zfb:Y, 6zfb:y |
20 | 6wvk:D | 1184 | 33 | 0.1176 | 0.0101 | 0.3636 | 3.1 | 6wvj:D |
21 | 4iub:L | 602 | 26 | 0.0980 | 0.0166 | 0.3846 | 6.3 | 5d51:L, 4iuc:L, 4iud:L, 5mdj:L, 5mdk:L, 5mdl:L, 7odg:L, 7odh:L, 8pou:L, 8pov:L, 8pow:L, 8pox:L, 8poz:L, 3rgw:L, 4ttt:L |
22 | 4rku:G | 84 | 16 | 0.0882 | 0.1071 | 0.5625 | 7.2 | |
23 | 4ln1:B | 321 | 49 | 0.1373 | 0.0436 | 0.2857 | 7.3 | 4ln1:A, 4ln1:C, 4ln1:D |
24 | 2c9o:A | 398 | 27 | 0.0980 | 0.0251 | 0.3704 | 7.3 | 2c9o:B |
25 | 5zji:G | 97 | 16 | 0.0882 | 0.0928 | 0.5625 | 7.7 | |
26 | 7bcb:B | 97 | 24 | 0.0980 | 0.1031 | 0.4167 | 9.4 | 7bca:A, 7bca:B, 7bcb:A |