MAPGDIEDMIKAGIPGARVTIRDLAGDGDHYAAEVVAEAFRGKTRVQQHQMVYNALKGNMGGILHALALQTSAPE
The query sequence (length=75) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 5nfm:A | 75 | 75 | 1.0000 | 1.0000 | 1.0000 | 5.26e-51 | 5nfl:A |
2 | 3tr3:B | 81 | 71 | 0.3733 | 0.3457 | 0.3944 | 3.08e-13 | 3tr3:A |
3 | 2ihv:A | 563 | 23 | 0.1600 | 0.0213 | 0.5217 | 1.1 | 2iht:A, 2iht:B, 2iht:C, 2iht:D, 2ihu:A, 2ihu:B, 2ihu:C, 2ihu:D, 2ihv:B, 2ihv:C, 2ihv:D, 1upa:A, 1upa:B, 1upa:C, 1upa:D, 1upb:A, 1upb:B, 1upb:C, 1upb:D, 1upc:A, 1upc:B, 1upc:C, 1upc:D, 1upc:E, 1upc:F |
4 | 8rwj:D | 676 | 69 | 0.2400 | 0.0266 | 0.2609 | 2.7 | 8rwj:I, 8rwj:A, 8rwj:B, 8rwj:C, 8rwj:E, 8rwj:F, 8rwj:G, 8rwj:H, 1ry2:A |
5 | 5f55:A | 705 | 46 | 0.1733 | 0.0184 | 0.2826 | 3.8 | 5f54:A, 5f56:A, 6lrd:A |
6 | 5mrc:NN | 115 | 43 | 0.2000 | 0.1304 | 0.3488 | 7.7 | 8d8k:N, 8d8l:N, 5mre:NN, 5mrf:NN, 8om2:N, 8om3:N, 8om4:N |
7 | 2x7f:A | 276 | 30 | 0.1067 | 0.0290 | 0.2667 | 9.0 | 5ax9:B, 2x7f:D, 2x7f:E |
8 | 6ra7:A | 302 | 30 | 0.1067 | 0.0265 | 0.2667 | 9.1 | 5ax9:A, 5ax9:C, 5d7a:A, 5d7a:B, 5d7a:C, 5di1:A, 5j95:A, 4obp:A, 6ra5:A, 4rvt:A, 4u40:A, 4u42:A, 4u43:A, 4u44:A, 4u45:A, 5w5q:A, 8wm0:A, 2x7f:B, 2x7f:C, 7xzq:A, 7xzr:A, 7xzr:B, 4zk5:A, 4zp5:A |