MAPELQLEYMPVLFTRTILGPQGGFAGEERLVKLEVARKYMEAGHAVTPTEELRRGLWCYNPDTDKYDCFIERNEEFLDF
AARKRQWLDVYWRVNTGYLLFGRQSWGQGFLINCPLRKRDVAQKLWEQYKVRIDPRLIEFREKDRRTGIQELGHNWCWLY
LPGAEELGINREVYDNKRVKVRIHVRKMNSMFALY
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 6yxx:BR | 196 | 195 | 1.0000 | 0.9949 | 1.0000 | 3.18e-146 | 7aoi:BR, 6hiv:BR, 6hix:BR, 6yxy:BR |
2 | 7aih:Ar | 195 | 195 | 0.8256 | 0.8256 | 0.8256 | 1.40e-125 | 7am2:Ar, 7ane:Ar |
3 | 1u17:A | 185 | 41 | 0.0718 | 0.0757 | 0.3415 | 2.6 | 1np1:A, 1np1:B, 2np1:A, 2np1:B, 3np1:A, 3np1:B, 4np1:A, 4np1:B, 1u17:B, 1u18:A, 1u18:B |
4 | 2lcp:A | 190 | 34 | 0.0667 | 0.0684 | 0.3824 | 3.9 | 5aeq:A, 5aeq:B, 5aer:A, 5afp:B, 5afp:A, 8ahy:B, 8alh:B, 8alm:B, 1g8i:A, 1g8i:B, 4guk:A, 4guk:C, 4guk:B, 4guk:D, 4ov2:A, 4ov2:B, 4ov2:C, 4ov2:D, 6qi4:B, 6qi4:C, 4yru:A, 4yru:B, 4yru:C, 4yru:D |
5 | 4a2m:B | 750 | 49 | 0.0769 | 0.0200 | 0.3061 | 3.9 | 4a2l:E, 4a2m:A, 4a2m:C, 4a2m:D |