MAPELQLEYIPIIFTRTILGPQGGFAGEERLIKREVAQKYMSEGNAVTPSAEFHQGVWCYNPDSEQYDRFVERNAEFLDF
AARKRQWLDVYWRVNTGYLLFGRQSWGQGWLLNCPLRKKDIAQKLWEQYKVRVDPRLIEFREKDRRTGIQDLGHNWCWLY
LPGAEELAIDREVYDNKRVKVRMHIRKMSSYGALY
The query sequence (length=195) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7aih:Ar | 195 | 195 | 1.0000 | 1.0000 | 1.0000 | 4.96e-147 | 7am2:Ar, 7ane:Ar |
2 | 6yxx:BR | 196 | 195 | 0.8256 | 0.8214 | 0.8256 | 1.52e-125 | 7aoi:BR, 6hiv:BR, 6hix:BR, 6yxy:BR |
3 | 7whs:A | 366 | 71 | 0.0974 | 0.0519 | 0.2676 | 2.7 | 7whs:B, 7whs:C, 7whs:D, 7whs:E, 7whs:F, 7wht:A, 7wht:B, 7wht:C, 7wht:D, 7wht:E, 7wht:F |
4 | 6l8h:A | 466 | 113 | 0.1487 | 0.0622 | 0.2566 | 4.7 | 6l8h:B, 6l8h:C, 6l8h:D |
5 | 4v36:A | 325 | 71 | 0.1026 | 0.0615 | 0.2817 | 8.6 | |
6 | 6jyx:B | 293 | 143 | 0.1795 | 0.1195 | 0.2448 | 8.7 | 6jyx:A |