MALTFITYIGCGLSSIFLSVTLVTYIAFEKIRRDYPSKILIQLCAALLLLNLIFLLDSWIALYNTRGFCIAVAVFLHYFL
LVSFTWMGLEAFHMYLALVKVFNTYIRKYILKFCIVGWGIPAVVVSIVLTISPDNYGIPNGTPDDFCWINSNVVFYITVV
GYFCVIFLLNVSMFIVVLVQLCRIKKKKQLGIQDLRSIAGLTFLLGITWGFAFFAWGVNVTFMYLFAIFNTLQGFFIFIF
YCAAKENVRKQWR
The query sequence (length=253) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7xkd:R | 261 | 259 | 0.9960 | 0.9655 | 0.9730 | 0.0 | 7wui:R, 7xke:R, 7xkf:R |
2 | 7d76:R | 265 | 253 | 0.3913 | 0.3736 | 0.3913 | 6.13e-48 | 7d77:R |
3 | 6lpb:R | 331 | 242 | 0.2490 | 0.1903 | 0.2603 | 4.85e-11 | |
4 | 8e3y:R | 372 | 228 | 0.2332 | 0.1586 | 0.2588 | 1.48e-10 | 8e3z:R, 6vn7:R |
5 | 8e3x:R | 362 | 272 | 0.2609 | 0.1823 | 0.2426 | 1.83e-10 | 6m1i:A, 6p9y:R |
6 | 6pb0:R | 281 | 270 | 0.2688 | 0.2420 | 0.2519 | 9.38e-10 | 8gtg:A, 8gti:A, 8gtm:A, 4k5y:C |
7 | 6nbh:R | 379 | 200 | 0.1976 | 0.1319 | 0.2500 | 2.92e-08 | 8flt:R, 8ha0:R, 8haf:R, 8jr9:R, 6nbf:R, 6nbi:R |
8 | 6pb1:P | 281 | 268 | 0.2609 | 0.2349 | 0.2463 | 5.05e-08 | |
9 | 7vvo:R | 302 | 246 | 0.2372 | 0.1987 | 0.2439 | 6.51e-08 | 8gw8:R |
10 | 6wzg:R | 379 | 202 | 0.1897 | 0.1266 | 0.2376 | 1.29e-07 | 7d3s:R, 6wi9:R |
11 | 7wu4:R | 286 | 267 | 0.2846 | 0.2517 | 0.2697 | 5.61e-07 | 7wu3:R, 7wu5:R |
12 | 6fj3:A | 562 | 120 | 0.1383 | 0.0623 | 0.2917 | 1.18e-05 | 8d51:A, 8d52:A, 7uzo:A, 7uzp:A, 7uzp:C, 7uzp:E |
13 | 6fj3:A | 562 | 34 | 0.0474 | 0.0214 | 0.3529 | 4.2 | 8d51:A, 8d52:A, 7uzo:A, 7uzp:A, 7uzp:C, 7uzp:E |
14 | 8g2y:R | 251 | 253 | 0.2648 | 0.2669 | 0.2648 | 1.75e-05 | |
15 | 7knu:R | 341 | 263 | 0.2451 | 0.1818 | 0.2357 | 1.88e-04 | |
16 | 7f16:R | 376 | 203 | 0.1976 | 0.1330 | 0.2463 | 5.25e-04 | |
17 | 7vqx:R | 361 | 192 | 0.1621 | 0.1136 | 0.2135 | 0.001 | 7wbj:R |
18 | 4z9g:A | 421 | 148 | 0.1462 | 0.0879 | 0.2500 | 0.001 | 4k5y:A, 4k5y:B, 4z9g:B, 4z9g:C |
19 | 7tyn:R | 373 | 203 | 0.1818 | 0.1233 | 0.2266 | 0.004 | 9auc:R, 8f0j:R, 8f0k:R, 8f2b:R, 6niy:R, 7tyf:R, 7tyo:R, 7tyw:R, 7tyx:R, 7tyy:R, 7tzf:R |
20 | 7dur:R | 371 | 207 | 0.1897 | 0.1294 | 0.2319 | 0.008 | 7lll:R, 7lly:R |
21 | 7lci:R | 393 | 216 | 0.2095 | 0.1349 | 0.2454 | 0.064 | 7c2e:R, 7duq:R, 7e14:R, 7evm:R, 7fim:R, 8jip:R, 8jir:R, 8jis:R, 7lcj:R, 7lck:R, 5nx2:A, 6orv:RP, 7s15:R, 7s1m:R, 7vbh:R, 7vbi:R, 6vcb:R, 6x19:R, 6x1a:R, 7x8r:R, 7x8s:R, 6xox:R |
22 | 6whc:R | 371 | 200 | 0.1700 | 0.1159 | 0.2150 | 0.096 | 8jru:R, 8wg8:R |
23 | 7fin:R | 380 | 224 | 0.2292 | 0.1526 | 0.2589 | 0.13 | 7dty:R, 7fiy:R, 7rbt:R, 7vab:R, 8yw4:R |
24 | 6wpw:R | 398 | 205 | 0.1937 | 0.1231 | 0.2390 | 0.41 | 8fu6:R, 8jiq:R, 8jit:R, 8jiu:R, 6lmk:R, 6lml:R, 7v35:R |
25 | 2cfa:A | 180 | 58 | 0.0711 | 0.1000 | 0.3103 | 0.82 | 2cfa:B, 4fzb:H, 4fzb:J, 4fzb:N |
26 | 8jrv:R | 319 | 194 | 0.1700 | 0.1348 | 0.2216 | 0.83 | |
27 | 7vrj:3 | 65 | 41 | 0.0593 | 0.2308 | 0.3659 | 4.1 | 8wdu:3, 8wdv:3 |
28 | 6kjv:B | 424 | 169 | 0.1462 | 0.0873 | 0.2189 | 8.2 | 6kjv:A, 6kk1:A, 6kk1:B, 6kk7:A, 6kk7:B, 5vew:A, 5vew:B, 5vex:A, 5vex:B |