MALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFVHRLAEESRTNACASKCRVINKEHVLAAAK
VILKKSRG
The query sequence (length=88) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7r5s:W | 88 | 88 | 1.0000 | 1.0000 | 1.0000 | 7.73e-59 | 7ywx:W |
2 | 1jfi:B | 135 | 61 | 0.1932 | 0.1259 | 0.2787 | 0.022 | |
3 | 6xiv:A | 257 | 43 | 0.1705 | 0.0584 | 0.3488 | 0.49 | 6xiu:A, 6xiu:B, 6xiv:B |
4 | 2waz:X | 315 | 30 | 0.1477 | 0.0413 | 0.4333 | 0.92 | 1anv:A, 2wb0:X |
5 | 6pqp:A | 615 | 57 | 0.1932 | 0.0276 | 0.2982 | 3.1 | 7or0:A, 7or0:B, 7or0:C, 7or0:D, 7or1:A, 7or1:B, 7or1:C, 7or1:D, 6pqo:D, 6pqo:A, 6pqo:B, 6pqo:C, 6pqp:B, 6pqp:D, 6pqp:C, 6pqq:A, 6pqq:D, 6pqq:B, 6pqq:C, 6v9v:A, 6v9v:B, 6v9v:D, 6v9v:C, 6v9w:A, 6v9w:B, 6v9w:D, 6v9w:C |
6 | 2e8y:A | 712 | 36 | 0.1250 | 0.0154 | 0.3056 | 7.5 | 2e8y:B, 2e8z:A, 2e8z:B, 2e9b:A, 2e9b:B |
7 | 5hmq:D | 624 | 55 | 0.1705 | 0.0240 | 0.2727 | 9.8 | 5hmq:A, 5hmq:B, 5hmq:C, 5hmq:E, 5hmq:F |