BioLiP

>protein
MALLQKTRIINSMLQAAAGKPVNFKEMAETLRDVIDSNIFVVSRRGKLLGYSINQQIENDRMKKMLEDRQFPEEYTKNLF
NVPETSSNLDINSEYTAFPVENRDLFQAGLTTIVPIIGGGERLGTLILSRLQDQFNDDDLILAEYGATVVGMEIL

The query sequence (length=155) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	5loe:A	258	155	0.9935	0.5969	0.9935	2.63e-111	2b18:A, 2gx5:C, 2hgv:A, 5loe:B, 5loe:C, 5loe:D
2	8c7s:A	256	155	0.5419	0.3281	0.5419	2.05e-58	8c7s:B, 5ey0:B, 5ey0:A, 5ey1:A, 5ey1:B
3	8c7u:D	262	159	0.4839	0.2863	0.4717	1.26e-45	8c7u:A, 8c7u:B, 8c7u:C
4	5n0l:A	156	158	0.4774	0.4744	0.4684	1.29e-41	5n0l:B, 5n0l:C, 5n0l:D, 5n0l:E, 5n0l:F
5	4onj:B	333	42	0.0839	0.0390	0.3095	0.78	4onj:A, 4onq:A, 4onq:B
6	6can:A	616	43	0.0774	0.0195	0.2791	1.5	6can:B, 5t88:A, 5t88:B
7	5mga:A	1182	152	0.2258	0.0296	0.2303	3.5
8	4eys:A	343	62	0.1290	0.0583	0.3226	3.6
9	8qpw:F	175	23	0.0710	0.0629	0.4783	4.8
10	7twc:A	416	47	0.0968	0.0361	0.3191	5.6	7twe:A, 7twe:B
11	6pcm:A	793	75	0.1226	0.0240	0.2533	5.8	6pcm:B
12	8btg:B	335	55	0.0839	0.0388	0.2364	6.4	8btg:A, 8btg:C, 8btg:D, 8btg:E, 8btg:F, 8btg:G, 8bv3:A, 8bv3:B, 8bv3:C, 8bv3:D, 8bv3:E
13	3bpt:A	362	60	0.1161	0.0497	0.3000	6.8
14	1ywf:A	241	148	0.1935	0.1245	0.2027	8.5
15	8a1d:A	533	33	0.0839	0.0244	0.3939	8.6	8a1d:B, 8a1d:C, 8a1d:D, 8a1d:E, 8a1d:F, 8a1d:G, 8a1d:H, 8a1d:I, 8a1d:J, 8a1d:K, 8a1d:L, 8a1d:M, 8a1d:N, 8a1d:O, 8a1d:P, 8a1s:A, 8a1s:B, 8a1s:C, 8a1s:D, 8a1s:E, 8a1s:F, 8a1s:G, 8a1s:H, 8a1s:I, 8a1s:J, 8a1s:K, 8a1s:L, 8a1s:M, 8a1s:N, 8a1s:O, 8a1s:P
16	6u0o:B	288	44	0.0968	0.0521	0.3409	9.5

[Back]