MALFGYARVSTSQQSLDIQVRALKDAGVKANRIFTDKASGSSSDRKGLDLLRMKVKEGDVILVKKLDRLGRDTADMIQLI
KEFDAQGVSIRFIDDGISTDSYIGKMVVTILSAVAQAERQRILQRTNEGRQEAMAKGVVFGRKRKIDRDAVLNMWQQGLG
ASHISKTMNIARSTVYKVINESN
The query sequence (length=183) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 1gdt:A | 183 | 183 | 0.9672 | 0.9672 | 0.9672 | 4.29e-126 | 1gdt:B, 2gm4:A, 2gm4:B, 1zr2:A, 1zr2:B, 1zr4:A, 1zr4:B, 1zr4:E, 1zr4:D |
2 | 5cy1:A | 183 | 182 | 0.7596 | 0.7596 | 0.7637 | 6.66e-98 | 5cy1:B, 5cy2:A, 5cy2:B, 5cy2:E, 5cy2:F |
3 | 4m6f:A | 188 | 178 | 0.3552 | 0.3457 | 0.3652 | 2.72e-32 | |
4 | 2r0q:C | 193 | 195 | 0.3333 | 0.3161 | 0.3128 | 3.32e-20 | 2r0q:D, 2r0q:E, 2r0q:F |
5 | 6yxx:EA | 532 | 51 | 0.0929 | 0.0320 | 0.3333 | 1.6 | 7aoi:XL, 6yxy:EA |
6 | 4af0:A | 395 | 68 | 0.0929 | 0.0430 | 0.2500 | 6.3 | 4af0:B |
7 | 6evj:C | 748 | 76 | 0.1421 | 0.0348 | 0.3421 | 9.3 | 6evj:F, 6evk:C, 9f2r:C, 9f37:C, 6fhh:C, 6fhi:C, 5m3h:C, 6szu:C, 6szv:C, 6t0n:C, 6t0r:C, 6t0s:C, 6t0u:C, 6t0v:C, 6tw1:C, 4wsb:C |