Home Research COVID-19 Services Publications People Teaching Job Opening News Forum --> -->
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●DMFold ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP
>protein
MAKDSKAPVVEIFDERDGCTSAGSTGKASDAGEKGLLVKVSMQKVGYNAIMAKSVAASYMNK

The query sequence (length=62) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

# Hit Hit
length 		Aligned
length 		Identity
(normalized by query) 		Identity
(normalized by hit) 		Identity (normalized
by aligned length) 		E-value Homologs
to hit
1 7s96:A 63 61 0.9839 0.9683 1.0000 2.49e-39 7s96:C, 7s97:C, 7t89:A, 7t89:C
2 4lm6:A 62 62 0.6613 0.6613 0.6613 2.73e-22 4lm6:C
3 4lmx:C 66 59 0.5806 0.5455 0.6102 5.21e-17 8el3:A, 8el3:J, 8el3:G, 8el3:K, 8el4:A, 8el4:F, 8el5:A, 8el5:J, 8el5:K, 8el5:G, 8el6:A, 8el6:F
4 4lmx:E 66 62 0.5806 0.5455 0.5806 1.65e-15 8el3:C, 8el3:I, 8el3:E, 8el3:L, 8el4:C, 8el4:E, 8el5:C, 8el5:I, 8el5:E, 8el5:L, 8el6:C, 8el6:E, 4lmx:A, 4lmx:G, 4lmx:I, 4lmx:K
5 7ssf:A 72 67 0.5000 0.4306 0.4627 1.57e-10 7ssf:C, 7ssf:E, 7ssf:G
6 4lms:A 80 42 0.3387 0.2625 0.5000 1.82e-04
7 7t8s:D 70 57 0.3387 0.3000 0.3684 0.001 7t8s:H, 7t8s:L, 7t8s:P
8 7tja:G 67 57 0.3387 0.3134 0.3684 0.004 7tja:Q, 7tja:C, 7tja:K, 7tja:O, 7tlf:C, 7tlf:G, 7tlf:K, 7tlf:O
9 1qgw:B 67 64 0.3710 0.3433 0.3594 0.007 1xf6:B, 1xg0:B
10 1qgw:A 76 47 0.3226 0.2632 0.4255 0.011 1xf6:A, 1xg0:A
11 7tja:I 75 46 0.3226 0.2667 0.4348 0.015 7tja:A, 7tja:R, 7tja:E, 7tja:M, 7tlf:A, 7tlf:E, 7tlf:I, 7tlf:M
12 7t7u:C 70 48 0.3065 0.2714 0.3958 0.023
13 7t7u:A 81 47 0.2581 0.1975 0.3404 0.038
14 7t8s:B 78 46 0.2903 0.2308 0.3913 0.065 7t8s:F, 7t8s:J, 7t8s:N
15 5e76:A 492 32 0.1613 0.0203 0.3125 2.5
16 5lej:B 237 33 0.2097 0.0549 0.3939 3.4 2beo:A, 8cb4:A, 8cb4:B, 8cb5:A, 8cb5:B, 8cb7:A, 8cb7:B, 8cb8:B, 8cb8:A, 8cbg:A, 8cbg:B, 8cbi:B, 8cbi:A, 6eut:A, 6eut:B, 6euu:B, 6euz:A, 6euz:B, 6ev0:A, 6ev0:B, 6exk:A, 6exk:B, 6exl:A, 6exl:B, 6exm:A, 6exm:B, 5f1r:A, 5f1r:B, 6hck:A, 5lej:A, 5lek:A, 5lek:B, 5lrr:A, 5lrr:B, 5lrr:C, 5lrr:D, 5lrr:E, 5lrr:F, 5lrr:G, 5lrr:H, 5lrs:A, 5lrs:B, 6qwf:A, 6qwf:B, 6qwh:A, 6qwh:B, 6qwk:A, 6qwk:B, 6qwm:A, 6qwm:B, 6t5i:A, 5x6d:A, 5x6d:B, 5x6d:H, 5x6d:G, 5x6d:M, 5x6d:N, 5x6e:M, 5x6e:N, 5x6e:B, 5x6e:A, 5x6e:E, 5x6e:F
17 8erb:K 429 56 0.1935 0.0280 0.2143 7.5 8erb:A, 8erb:C, 8erb:B, 8erb:D, 8erb:G, 8erb:H, 8erb:F, 8erb:P, 8erb:I, 8erb:J, 8erb:M, 8erb:E, 8erb:Q, 8erb:N, 8erb:L, 8erj:A, 8erj:B, 8erj:C, 8erj:D, 8erj:E, 8erj:F, 8erj:H, 8erj:G

[Back]
Reference:
  • Chengxin Zhang, Xi Zhang, Peter L Freddolino, and Yang Zhang. BioLiP2: an updated structure database for biologically relevent ligand-protein interactions, Nucleic Acids Research, gkad630 (2023).
  • Jianyi Yang, Ambrish Roy, and Yang Zhang. BioLiP: a semi-manually curated database for biologically relevant ligand-protein interactions, Nucleic Acids Research, 41: D1096-D1103 (2013) (download the PDF file).

    • yangzhanglabumich.edu | (734) 647-1549 | 100 Washtenaw Avenue, Ann Arbor, MI 48109-2218