MAIKFNIKESKILNGVYIITPNKFSDLRGDIWTAFTDEYLSNLVPNGIKFKHDKFINSHFNVLRGIHGDVKTYKLVTCVY
GEVHQVVVDCRKDSPTYLKWEKFIISPRNQQLILLPPNMGNSHYVSSKEAVYYYKLAYKGEYLDAPDQFTYAWNDKRIAI
DWPTNSPILSERDILAMN
The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 8dco:B | 181 | 178 | 1.0000 | 0.9834 | 1.0000 | 1.25e-133 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
2 | 7m15:D | 181 | 176 | 0.8876 | 0.8729 | 0.8977 | 4.78e-120 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
3 | 8dcl:A | 185 | 175 | 0.7697 | 0.7405 | 0.7829 | 4.31e-104 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
4 | 1dzt:A | 183 | 165 | 0.3034 | 0.2951 | 0.3273 | 4.12e-24 | 1dzt:B |
5 | 3ryk:A | 175 | 174 | 0.2865 | 0.2914 | 0.2931 | 3.17e-20 | 3ryk:B |
6 | 6ndr:A | 188 | 162 | 0.2978 | 0.2819 | 0.3272 | 3.68e-20 | 6ndr:B |
7 | 2ixh:A | 184 | 161 | 0.2697 | 0.2609 | 0.2981 | 8.96e-20 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
8 | 6c46:A | 183 | 166 | 0.2921 | 0.2842 | 0.3133 | 1.09e-18 | 6c46:D |
9 | 1epz:A | 183 | 170 | 0.3034 | 0.2951 | 0.3176 | 3.11e-16 | |
10 | 7pvi:AAA | 199 | 162 | 0.2809 | 0.2513 | 0.3086 | 3.51e-16 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
11 | 5buv:A | 174 | 177 | 0.3090 | 0.3161 | 0.3107 | 4.94e-14 | 5buv:B |
12 | 2ixc:A | 198 | 168 | 0.2640 | 0.2374 | 0.2798 | 6.03e-14 | 2ixc:B, 2ixc:C, 2ixc:D |
13 | 1oi6:A | 202 | 174 | 0.2640 | 0.2327 | 0.2701 | 5.15e-11 | 1oi6:B |
14 | 7pwh:AAA | 203 | 165 | 0.2640 | 0.2315 | 0.2848 | 9.76e-10 | |
15 | 4hn1:C | 201 | 165 | 0.2472 | 0.2189 | 0.2667 | 5.71e-06 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
16 | 1vli:A | 358 | 114 | 0.1517 | 0.0754 | 0.2368 | 0.12 | |
17 | 8auv:C | 117 | 63 | 0.1067 | 0.1624 | 0.3016 | 0.97 | 8b2l:C1 |
18 | 7cp7:A | 430 | 87 | 0.1180 | 0.0488 | 0.2414 | 2.8 | 7cp6:A, 7cp6:B |
19 | 7rml:A | 281 | 81 | 0.1292 | 0.0819 | 0.2840 | 3.2 | 7rml:B, 7rml:C |
20 | 7pmk:Q | 766 | 31 | 0.0674 | 0.0157 | 0.3871 | 7.8 | 7pmn:Q |