BioLiP

>protein
MAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTDEYLSKLVPDGIKFKHDKFINSHFNVLRGIHGDVKTYKLVTCVY
GEVHQVVVDCYLKWEKFIISYKNQQLILLPPNMGNSHYVSSAAAVYYYKLAYEGEYMDAPDQFTYAWNDERIGIDWPTNT
PILSDRDILATKNK

The query sequence (length=174) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7m15:D	181	180	1.0000	0.9613	0.9667	3.63e-128	7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F
2	8dco:B	181	176	0.8736	0.8398	0.8636	8.54e-113	8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A
3	8dcl:A	185	179	0.7931	0.7459	0.7709	2.76e-102	7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B
4	1dzt:A	183	165	0.2931	0.2787	0.3091	2.02e-18	1dzt:B
5	6ndr:A	188	162	0.2874	0.2660	0.3086	5.59e-15	6ndr:B
6	6c46:A	183	166	0.2874	0.2732	0.3012	3.14e-14	6c46:D
7	2ixh:A	184	161	0.2471	0.2337	0.2671	2.84e-12	2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B
8	3ryk:A	175	180	0.2586	0.2571	0.2500	1.85e-11	3ryk:B
9	1epz:A	183	168	0.2701	0.2568	0.2798	3.01e-09
10	7pvi:AAA	199	177	0.2701	0.2362	0.2655	3.84e-09	7pvi:BBB, 7pwb:AAA, 7pwb:BBB
11	2ixc:A	198	170	0.2414	0.2121	0.2471	6.30e-08	2ixc:B, 2ixc:C, 2ixc:D
12	5buv:A	174	167	0.2529	0.2529	0.2635	8.62e-06	5buv:B
13	7pwh:AAA	203	165	0.2529	0.2167	0.2667	5.36e-04
14	4ip4:A	421	64	0.0862	0.0356	0.2344	0.99	4ip4:B, 4ip5:A, 4ip5:B
15	1vli:A	358	108	0.1264	0.0615	0.2037	1.6
16	6xyw:BC	68	48	0.1092	0.2794	0.3958	2.7

[Back]