MAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTDEYLSKLVPDGIKFKHDKFINSHFNVLRGIHGDVKTYKLVTCVY
GEVHQVVVDCRKDSPTYLKWEKFIISYKNQQLILLPPNMGNSHYVSSAAAVYYYKLAYEGEYMDAPDQFTYAWNDERIGI
DWPTNTPILSDRDILATKNKG
The query sequence (length=181) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.
# | Hit | Hit length |
Aligned length |
Identity (normalized by query) |
Identity (normalized by hit) |
Identity (normalized by aligned length) |
E-value | Homologs to hit |
---|---|---|---|---|---|---|---|---|
1 | 7m15:D | 181 | 181 | 1.0000 | 1.0000 | 1.0000 | 1.62e-136 | 7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F |
2 | 8dco:B | 181 | 176 | 0.8729 | 0.8729 | 0.8977 | 4.10e-120 | 8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A |
3 | 8dcl:A | 185 | 180 | 0.8011 | 0.7838 | 0.8056 | 1.13e-110 | 7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B |
4 | 1dzt:A | 183 | 165 | 0.3094 | 0.3060 | 0.3394 | 4.33e-25 | 1dzt:B |
5 | 6ndr:A | 188 | 162 | 0.2928 | 0.2819 | 0.3272 | 7.88e-20 | 6ndr:B |
6 | 3ryk:A | 175 | 174 | 0.2707 | 0.2800 | 0.2816 | 1.65e-18 | 3ryk:B |
7 | 6c46:A | 183 | 166 | 0.2873 | 0.2842 | 0.3133 | 2.22e-18 | 6c46:D |
8 | 2ixh:A | 184 | 161 | 0.2597 | 0.2554 | 0.2919 | 3.88e-18 | 2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B |
9 | 7pvi:AAA | 199 | 177 | 0.2818 | 0.2563 | 0.2881 | 2.76e-15 | 7pvi:BBB, 7pwb:AAA, 7pwb:BBB |
10 | 1epz:A | 183 | 168 | 0.2818 | 0.2787 | 0.3036 | 3.52e-14 | |
11 | 2ixc:A | 198 | 170 | 0.2541 | 0.2323 | 0.2706 | 3.13e-13 | 2ixc:B, 2ixc:C, 2ixc:D |
12 | 5buv:A | 174 | 167 | 0.2707 | 0.2816 | 0.2934 | 3.04e-11 | 5buv:B |
13 | 1oi6:A | 202 | 177 | 0.2707 | 0.2426 | 0.2768 | 2.17e-10 | 1oi6:B |
14 | 7pwh:AAA | 203 | 165 | 0.2652 | 0.2365 | 0.2909 | 4.98e-09 | |
15 | 4hn1:C | 201 | 178 | 0.2541 | 0.2289 | 0.2584 | 1.95e-06 | 4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D |
16 | 8bf8:A | 302 | 61 | 0.0939 | 0.0563 | 0.2787 | 0.99 | |
17 | 1vli:A | 358 | 114 | 0.1436 | 0.0726 | 0.2281 | 1.1 | |
18 | 7cp7:A | 430 | 87 | 0.1215 | 0.0512 | 0.2529 | 1.2 | 7cp6:A, 7cp6:B |
19 | 8h1j:A | 362 | 61 | 0.0939 | 0.0470 | 0.2787 | 2.3 | 8ex9:A, 8exa:A |
20 | 8auv:C | 117 | 63 | 0.1050 | 0.1624 | 0.3016 | 2.6 | 8b2l:C1 |