BioLiP

>protein
MAIEFDIQESKILKGVYIITPNKFRDLRGEIWTAFTDEYLSKLVPDGIKFKHDKFINSHFNVLRGIHGDVKTYKLVTCVY
GEVHQVVVDCRKDSPTYLKWEKFIISYKNQQLILLPPNMGNSHYVSSAAAVYYYKLAYEGEYMDAPDQFTYAWNDERIGI
DWPTNTPILSDRDILATK

The query sequence (length=178) is searched through a non-redundant set of database sequences protein_nr.fasta.gz clustered at 90% identity cutoff to identify representative hits. Homologs that belong to the same sequence cluster of the representative hit are listed in the last column of the table.

#	Hit	Hit length	Aligned length	Identity (normalized by query)	Identity (normalized by hit)	Identity (normalized by aligned length)	E-value	Homologs to hit
1	7m15:D	181	178	1.0000	0.9834	1.0000	4.09e-134	7an4:A, 7an4:B, 7an4:D, 7m14:A, 7m14:B, 7m14:C, 7m14:D, 7m14:E, 7m14:F, 7m15:A, 7m15:B, 7m15:C, 7m15:E, 7m15:F
2	8dco:B	181	176	0.8876	0.8729	0.8977	3.36e-120	8db5:A, 8db5:B, 8db5:C, 8db5:D, 8db5:E, 8db5:F, 8db5:G, 8db5:H, 8dco:A
3	8dcl:A	185	177	0.7978	0.7676	0.8023	2.26e-108	7anj:A, 7anj:B, 8dak:A, 8dak:B, 8dcl:B
4	1dzt:A	183	165	0.3146	0.3060	0.3394	3.52e-25	1dzt:B
5	6ndr:A	188	162	0.2978	0.2819	0.3272	7.41e-20	6ndr:B
6	3ryk:A	175	174	0.2753	0.2800	0.2816	1.49e-18	3ryk:B
7	6c46:A	183	166	0.2921	0.2842	0.3133	1.99e-18	6c46:D
8	2ixh:A	184	161	0.2640	0.2554	0.2919	3.74e-18	2ixh:B, 2ixi:B, 2ixi:A, 2ixk:A, 2ixk:B
9	7pvi:AAA	199	177	0.2865	0.2563	0.2881	2.76e-15	7pvi:BBB, 7pwb:AAA, 7pwb:BBB
10	1epz:A	183	168	0.2865	0.2787	0.3036	3.28e-14
11	2ixc:A	198	170	0.2584	0.2323	0.2706	2.43e-13	2ixc:B, 2ixc:C, 2ixc:D
12	5buv:A	174	167	0.2753	0.2816	0.2934	2.79e-11	5buv:B
13	1oi6:A	202	177	0.2753	0.2426	0.2768	2.08e-10	1oi6:B
14	7pwh:AAA	203	165	0.2697	0.2365	0.2909	5.80e-09
15	4hn1:C	201	167	0.2416	0.2139	0.2575	2.26e-06	4hmz:A, 4hmz:B, 4hmz:C, 4hmz:D, 4hn1:A, 4hn1:B, 4hn1:D
16	8bf8:A	302	61	0.0955	0.0563	0.2787	0.88
17	1vli:A	358	114	0.1461	0.0726	0.2281	0.88
18	7cp7:A	430	87	0.1236	0.0512	0.2529	1.1	7cp6:A, 7cp6:B
19	8h1j:A	362	61	0.0955	0.0470	0.2787	2.0	8ex9:A, 8exa:A
20	8auv:C	117	63	0.1067	0.1624	0.3016	2.5	8b2l:C1

[Back]